Details for Arabidopsis Locus AT3G06810

Position : Chr3 ( 5`- 2146335 .. 2150831 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06810

Protein [Map View]
MGSSTGDLVTRIQSAHRFDHDALFRFAADNVSGFPTNPSQFKVSQFGHGQSNPTFLIEVGSGSSLKRYVLRKKPPGKLLQ
SAHAVDREFQVLRALGEHTQVPVPKVFCLCTDPAVIGTAFYIMEFMEGRIFIDPKLPNVAPERRNAIYRATAKALASLHS
ADVDAIGLEKYGRRGNYCKRQIDRWFKQYLASTSEGKPERNPKMFELVDWLRKNIPAEDSTGATSGLVHGDFRIDNLVFH
PSEDRVIGIIDWELSTLGNQMCDVAYSCMHYIVNVQLDKEHVSEGFETTGLPEGMLSMPEFLLEYCSASGKPWPAANWKF
YVAFSLFRAASIYTGVYSRWLMGNASAGERARNTGVQANELVESALGYIARENVLPEHPPSVQRDVSPSYESLVDGSGRF
IPNRKVLELRQKLIKFMETHIYPMENEFSKLAQSDMRWTVHPQEEKLKEMAKREGLWNLFVPVDSAARARRELAATENKH
NLSGKSFDQLFGEGLTNLEYGYLCEIMGRSVWAPQVFNCGAPDTGNMEVILRYGNKEQISEWLIPLLEGRIRSGFAMTEP
QVASSDATNIECSIRRQGDSYVINGTKWWTSGAMDPRCRVLILMGKTDFNAPKHKQQSMILVDMRTPGISVKRPLTVFGF
DDAPHGHAEISFENVVVPAKNILLGEGRGFEIAQGRLGPGRLHHCMRLIGAAERGMELMAQRALSRKTFGKFIAQHGSFV
SDLAKLRVELEGTRLLVLEAADHLDKFGNKKARGILAMAKVAAPNMALKVLDTAIQVHGAAGVSSDTVLAHLWATARTLR
IADGPDEVHLGTIGKLELQRASKL*

DNA
ATGGGAAGCAGCACGGGCGATCTTGTGACACGTATCCAATCAGCTCACCGTTTCGATCACGATGCCTTGTTTCGTTTTGC
CGCCGACAACGTCTCTGGCTTTCCGACCAACCCTTCCCAATTCAAAGTCTCACAGTTCGGACATGGGCAGTCGAATCCAA
CGTTTCTGATAGAGGTTGGCTCAGGGAGTTCCTTGAAACGATACGTTTTGAGGAAGAAGCCTCCTGGCAAGCTTCTTCAA
TCTGCTCATGCTGTTGATCGAGAGTTTCAGGTGCTTCGGGCTTTAGGTGAACATACACAGGTTCCTGTTCCTAAAGTCTT
CTGCTTATGCACTGACCCTGCTGTCATTGGGACTGCTTTTTACATTATGGAGTTTATGGAAGGACGTATTTTCATTGATC
CAAAGTTGCCGAATGTAGCACCTGAAAGGAGAAATGCGATCTATCGTGCAACCGCCAAAGCCTTGGCATCTCTTCACTCT
GCTGATGTGGATGCCATTGGTCTTGAGAAATATGGTCGGCGAGGCAATTACTGCAAAAGACAGATAGATAGGTGGTTCAA
ACAATATTTGGCTTCAACAAGTGAAGGTAAACCTGAAAGGAATCCAAAGATGTTTGAGCTTGTTGATTGGTTACGCAAAA
ACATCCCCGCGGAAGATTCAACTGGAGCAACATCAGGCCTTGTCCATGGAGACTTTCGCATTGACAATCTCGTTTTTCAT
CCTTCTGAGGATCGAGTTATTGGAATAATTGACTGGGAATTGTCCACGCTTGGGAACCAAATGTGTGATGTTGCATACAG
CTGCATGCATTACATTGTGAATGTTCAGCTCGATAAGGAGCATGTTAGTGAAGGTTTTGAAACTACTGGGCTTCCAGAAG
GAATGCTTTCGATGCCAGAATTTCTCTTAGAATACTGTTCTGCATCGGGAAAACCATGGCCTGCTGCAAACTGGAAGTTC
TACGTAGCGTTCTCCTTATTTCGGGCTGCTTCAATCTACACAGGGGTGTACAGTAGATGGTTAATGGGGAATGCTTCTGC
CGGTGAAAGAGCGCGAAATACAGGGGTTCAAGCTAATGAGCTTGTAGAGTCTGCCTTGGGTTATATTGCACGTGAAAATG
TTCTTCCAGAACACCCTCCATCTGTTCAAAGAGACGTGTCTCCGTCGTATGAAAGCCTTGTGGATGGAAGCGGGAGATTC
ATCCCCAACAGAAAAGTATTGGAGTTAAGGCAGAAGTTGATCAAGTTTATGGAAACTCATATCTACCCAATGGAAAACGA
GTTCTCCAAACTTGCTCAATCAGATATGCGATGGACCGTTCACCCTCAGGAGGAAAAGTTAAAGGAAATGGCAAAGAGAG
AAGGCCTATGGAACTTATTTGTTCCTGTAGATAGTGCTGCTAGAGCTAGAAGAGAACTGGCGGCTACCGAGAATAAACAT
AACCTCTCGGGCAAGTCTTTTGATCAATTGTTTGGTGAGGGCCTCACGAACCTGGAGTATGGTTACCTTTGTGAGATCAT
GGGTCGTTCTGTTTGGGCTCCACAGGTGTTTAACTGTGGTGCACCAGATACTGGAAACATGGAGGTGATACTGCGGTATG
GTAACAAAGAACAAATTTCTGAATGGCTTATTCCGTTGCTCGAGGGAAGAATTCGTTCTGGATTTGCTATGACTGAGCCA
CAAGTTGCATCGTCTGATGCAACCAATATTGAATGCTCTATCCGAAGACAAGGTGATTCATACGTCATTAATGGCACAAA
ATGGTGGACAAGTGGAGCTATGGATCCCAGGTGCAGAGTCCTTATTCTCATGGGAAAAACTGATTTCAACGCCCCAAAAC
ATAAGCAGCAGTCTATGATATTAGTGGACATGCGGACTCCAGGTATAAGTGTGAAGAGGCCTCTCACAGTGTTTGGTTTT
GATGACGCACCTCATGGACATGCTGAAATTTCTTTTGAAAATGTGGTTGTCCCGGCGAAGAACATTCTCCTTGGAGAAGG
CCGAGGATTCGAGATTGCTCAGGGTAGGTTAGGCCCTGGAAGACTGCACCATTGCATGAGACTAATAGGTGCAGCAGAGC
GTGGAATGGAGCTAATGGCTCAAAGAGCTCTGAGTAGAAAAACTTTTGGGAAGTTCATTGCGCAGCACGGTTCTTTCGTC
TCTGATCTTGCAAAGTTACGGGTAGAGCTAGAAGGAACCCGATTGTTGGTTCTAGAAGCTGCTGATCATCTTGATAAATT
TGGAAACAAAAAAGCTCGAGGAATTCTCGCAATGGCCAAGGTTGCAGCTCCAAACATGGCATTGAAGGTACTAGACACGG
CAATACAAGTTCATGGAGCAGCCGGTGTATCCTCGGACACAGTTTTAGCGCATTTGTGGGCTACAGCTAGAACACTGAGG
ATTGCTGATGGACCTGATGAGGTTCATCTTGGGACCATTGGCAAGTTAGAACTGCAAAGAGCTTCAAAGCTTTAA