Details for Arabidopsis Locus AT3G06790

Position : Chr3 ( 5`- 2144384 .. 2145776 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06790

Protein [Map View]
MALISTRRTLSTLLNKTLSSSTSYSSSFPTLSSRSRFAMPLIEKVSSSRTSLGPCYISTRPKTSGSGYSPLNDPSPNWSN
RPPKETILLDGCDYEHWLIVMEFTDPKPTEEEMINSYVKTLTSVLGWQEEAKKKIYSVCTSTYTGFGALISEELSCKVKA
LPGVLWVLPDSYLDVPNKDYGGDLYVEGKVIPRPQYRFTEQRHTRPRPRPRYDRRRETMQVERREPSMGLHSPVNPGEFN
KPSA*

DNA
ATGGCTCTTATCAGCACACGGCGAACATTATCGACACTCCTAAACAAAACCCTCTCTTCCTCTACTTCATATTCTTCTTC
ATTTCCTACGCTCTCTTCTCGTTCTCGATTCGCCATGCCTCTAATTGAAAAGGTTTCCTCTTCCCGAACCAGCCTGGGCC
CGTGTTACATCTCGACCCGACCCAAGACATCCGGGTCCGGATACTCGCCGCTGAATGATCCTTCGCCGAATTGGAGCAAC
CGTCCGCCGAAGGAGACGATTCTTCTTGATGGGTGCGATTATGAGCACTGGCTCATCGTCATGGAGTTCACTGATCCTAA
ACCTACTGAAGAAGAGATGATCAATTCTTATGTCAAAACCTTAACTTCCGTCCTTGGCTGGCAAGAAGAGGCCAAGAAGA
AGATTTACTCTGTTTGTACTTCGACCTACACTGGCTTTGGTGCTTTGATCTCTGAAGAGCTCTCTTGCAAAGTCAAAGCA
TTGCCTGGTGTTCTCTGGGTGCTGCCGGATTCCTATCTCGATGTACCAAACAAAGACTACGGAGGTGACTTGTACGTTGA
AGGAAAGGTCATACCCAGACCACAGTACAGGTTCACGGAACAGCGTCATACTAGACCCCGTCCTAGGCCAAGGTATGATA
GGCGCCGTGAGACAATGCAGGTTGAGAGGAGAGAGCCATCCATGGGTCTTCATTCTCCAGTAAATCCGGGAGAGTTCAAC
AAGCCCAGTGCTTAA