Details for Arabidopsis Locus AT3G06780

Position : Chr3 ( 5`- 2143488 .. 2144521 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06780

Protein [Map View]
MEFSLIADTVTVCTAKQGIAFGKSLLQRLDLANHISFADSVVDHQSPGGGIVQASAIIFPVDAIAPPPVRSSSYKTIRRI
RKKRRTRRVSFGGDGDDAGDFGRFLLEGDFGGSDGPFGFGGGGNDGGGKGWNYGGGGGGFGRDNWDGSSFSSWSDPAMEF
VYEVICWIALSNCVHFAFKRIVRIVTDGEREKLNIALSPVC*

DNA
ATGGAGTTCTCTTTGATCGCAGATACAGTCACAGTTTGCACGGCTAAGCAAGGTATCGCGTTTGGGAAATCTCTTCTTCA
AAGGTTGGATTTGGCCAATCACATTTCTTTCGCCGATTCCGTTGTTGATCATCAATCTCCCGGTGGAGGAATCGTTCAAG
CATCGGCGATTATTTTCCCCGTCGATGCAATTGCTCCTCCACCGGTCAGATCTAGCTCTTATAAGACAATTCGCCGGATC
CGTAAAAAGCGACGAACCAGGCGAGTTTCGTTTGGTGGAGATGGAGATGACGCAGGAGATTTTGGTCGTTTTCTGTTAGA
AGGTGATTTCGGTGGTAGCGACGGTCCATTTGGATTTGGAGGCGGAGGAAACGATGGAGGCGGAAAGGGATGGAACTACG
GCGGCGGCGGCGGTGGTTTCGGGAGGGATAATTGGGATGGGTCTTCGTTTTCGTCTTGGTCAGATCCAGCGATGGAATTT
GTGTATGAAGTGATTTGCTGGATCGCGTTGTCTAATTGTGTGCACTTTGCGTTCAAGAGGATAGTGAGGATCGTGACCGA
CGGTGAAAGGGAGAAGTTGAACATTGCATTATCTCCGGTATGCTGA