Details for Arabidopsis Locus AT3G06730

Position : Chr3 ( 5`- 2124217 .. 2126142 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06730

Protein [Map View]
MALVQSRTFPHLNTPLSPILSSLHAPSSLFIRREIRPVAAPFSSSTAGNLPFSPLTRPRKLLCPPPRGKFVREDYLVKKL
SAQELQELVKGDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFISPDPS
KDAIRTEGLIPLQMMHDIIDNEM*

DNA
ATGGCTCTTGTTCAATCCAGAACTTTTCCACACCTCAACACTCCGTTATCGCCGATTCTATCCTCCCTCCATGCTCCGTC
TTCTCTCTTTATCCGGAGGGAAATCCGACCGGTAGCCGCGCCGTTCTCCTCCTCCACCGCCGGAAACTTGCCCTTCTCGC
CGTTGACGCGTCCGCGAAAGCTTCTCTGTCCTCCGCCTCGCGGCAAGTTTGTCAGAGAAGATTATCTTGTGAAGAAATTG
TCAGCTCAAGAACTTCAGGAACTGGTGAAAGGAGATAGGAAGGTGCCGTTGATTGTTGATTTTTATGCGACATGGTGTGG
ACCTTGTATCTTGATGGCCCAGGAACTAGAAATGCTTGCAGTAGAGTATGAGAGCAATGCAATAATCGTGAAAGTTGATA
CAGATGATGAGTACGAGTTTGCACGCGACATGCAGGTTCGAGGGTTACCTACATTATTCTTCATCAGTCCTGACCCAAGC
AAAGATGCAATCAGGACAGAAGGGCTAATTCCGTTACAGATGATGCACGATATCATTGACAACGAGATGTGA