Details for Arabidopsis Locus AT3G06680

Position : Chr3 ( 5`- 2114151 .. 2114948 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06680

Protein [Map View]
MSPIFPLASLPFTQLCCAVVTEMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAG
VEE*

DNA
ATGTCACCTATCTTTCCTCTCGCGTCTCTCCCCTTTACTCAGTTGTGTTGTGCCGTTGTTACAGAAATGGCGAAATCGAA
GAATCACACGGCGCACAATCAGTCTGCCAAGGCGCATAAGAACGGAATCAAGAAGCCAAGGAGACACCGTCACACACCAA
CCAGAGGAATGGATCCTAAATTCCTAAGAAACCAGAGGTATGCAAGGAAGCACAACGTCAAGAGTGGCGAGAATGCTGGT
GTCGAAGAGTAG