Details for Arabidopsis Locus AT3G06670

Position : Chr3 ( 5`- 2105459 .. 2113698 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06670

Protein [Map View]
MGAPEKSQSNTNSMQRVKVYHLNEDGKWDDRGTGHVSIDFVERSEELSLCVIDEEDNETLLVHPINPEDIYRKQEDTIIS
WRDPERSTELALSFQETAGCSYVWDQICTMQRNLHFSSLNSETFHSLNSELRELPAVELTTLPLILKIVTESGITDQMRL
TELILKDHDFFRNLMGVFKICEDLENVDGLHMIFNIVKGIILLNSSQILEKIFGDELIMEIIGCLEYDPGVPHSQHHRNF
LKEHVVFKERQSHVFFVRKEHAHYGCFGISAIPIKDPLVLSKIHQTYRIGYLKDVVLARVLDDAIVANLNSVIHANNAIV
VSLLKDDSTFIQELFARLRSPSTSMESKKNLVYFLHEFCSLSKSLQVVQQLRLFRDLINEGIFHVIEEVLQIPDKKLVLT
GTDILILFLTQDPNLLRSYVVRTEGNPLLGLLVKGMMEDFGDKMHCQFLEIIRTLLDANALSGGAQRANIMDIFYEKHLP
ELVDVITASCPEKSSNASEGAARRIFTKPEVLLNICELLCFCIMQDASRTKCSFLQNNVTEKVLHLTRRKEKYLVVAAIR
FVRTLLSVHDDYVQNYVVKNNLLKPIIDVFIANGTRYNLLNSAVLDLLEHIRKGNATLLLKYIVDTFWDQLAPFQCLTSI
QAFKVKYEQCLESAGPKSTSDAVDPRRRVDERALEKEEEDYFNEDSDEEDSASASNTQKEKPASNIQKEQPKPHLSNGVA
ASPTSSSPRSGGLVDYEDDEDDEDYKPPPRKQPEASEDEEGELLRLKRKSALVEREQEPSKKPRLGKSSKRENVFAVLCS
TLSHAVLTGKKSPGPAGSAARSIVAKGAEDSKSSEENNSSSSDDENHKDDGVSSSEHETSDNGKLNGEESLVVAPKSSPE
MAVNGS*

DNA
ATGGGCGCTCCGGAAAAGTCTCAATCTAATACCAATTCGATGCAGAGAGTGAAAGTCTATCATTTGAATGAAGATGGTAA
ATGGGATGATCGAGGAACTGGGCACGTAAGCATCGACTTTGTGGAGCGATCTGAAGAACTCAGTCTATGTGTAATTGATG
AAGAAGATAACGAGACGTTACTTGTTCATCCCATCAACCCTGAGGATATTTACAGGAAACAAGAAGACACAATAATCTCA
TGGAGAGACCCAGAGCGCTCAACAGAATTGGCTTTAAGCTTTCAAGAGACTGCAGGGTGCTCTTATGTATGGGATCAAAT
CTGCACTATGCAACGAAATTTGCATTTCAGCTCTCTAAACAGCGAAACATTTCACAGCTTGAACAGTGAGTTGAGGGAGC
TTCCTGCTGTAGAGCTTACTACTCTTCCCCTAATACTGAAGATTGTTACAGAGAGTGGCATTACAGATCAGATGCGCCTA
ACTGAACTTATTTTGAAGGATCATGATTTCTTCCGGAATCTGATGGGTGTTTTTAAAATATGCGAGGACTTGGAAAATGT
TGATGGCCTTCACATGATATTCAACATTGTCAAGGGAATCATTTTGCTTAACAGTTCTCAGATCTTGGAGAAAATATTTG
GAGATGAATTGATTATGGAGATTATCGGATGCCTTGAATATGATCCTGGTGTTCCTCACTCTCAGCATCACCGGAATTTT
CTGAAGGAGCATGTTGTTTTTAAGGAGAGACAAAGTCATGTTTTTTTTGTAAGAAAAGAGCATGCTCACTATGGATGCTT
TGGGATTAGCGCTATACCAATCAAAGATCCCTTAGTCCTGTCAAAGATACACCAGACGTACAGAATTGGTTACTTGAAGG
ATGTTGTTTTGGCTAGAGTACTAGATGATGCTATTGTTGCAAACTTGAATTCTGTAATCCATGCGAACAATGCCATAGTA
GTTTCATTGCTGAAGGACGATAGCACTTTTATTCAAGAGTTATTTGCAAGGTTGAGGTCGCCTTCTACTTCTATGGAATC
CAAGAAAAATTTGGTATATTTCTTGCACGAATTTTGTAGTTTAAGCAAGAGCCTCCAGGTGGTGCAGCAGCTGCGACTTT
TTAGGGACCTTATTAATGAAGGCATTTTTCATGTCATAGAAGAAGTCTTGCAGATTCCAGACAAAAAACTCGTATTGACT
GGGACAGATATCCTGATTCTTTTCTTGACTCAAGACCCCAACCTTTTACGTTCTTATGTTGTTCGGACAGAAGGAAACCC
CCTCCTCGGTCTCCTGGTCAAGGGAATGATGGAAGACTTTGGTGATAAGATGCACTGCCAATTTCTAGAAATTATCCGTA
CCTTACTAGATGCAAATGCATTGTCTGGTGGAGCTCAGAGAGCAAATATCATGGATATTTTCTACGAGAAGCATCTACCT
GAGTTAGTGGATGTTATTACTGCCTCATGTCCTGAGAAGTCGAGCAACGCATCTGAAGGTGCTGCCAGAAGGATTTTCAC
AAAGCCTGAAGTCCTGTTGAACATATGTGAATTGTTGTGCTTTTGCATTATGCAAGATGCATCCAGGACAAAATGCAGTT
TTCTCCAAAACAATGTGACTGAAAAGGTTTTGCATCTCACACGGAGAAAGGAAAAATACCTAGTGGTCGCTGCTATACGA
TTTGTCCGTACTCTCCTCTCTGTCCATGATGATTATGTCCAGAATTACGTGGTTAAAAACAACTTGTTGAAACCGATCAT
AGATGTCTTCATTGCCAATGGAACCCGGTACAATCTGCTGAACTCTGCAGTCTTGGATCTGCTTGAGCACATACGCAAGG
GAAATGCAACTCTGTTGCTCAAATACATAGTTGATACGTTCTGGGACCAGTTGGCCCCATTTCAGTGCTTGACCTCCATC
CAGGCTTTCAAGGTTAAGTATGAACAGTGTTTAGAAAGTGCCGGACCAAAAAGCACTTCTGATGCGGTTGATCCAAGAAG
AAGAGTTGACGAGCGGGCATTGGAGAAAGAGGAAGAAGATTATTTCAATGAAGACAGCGATGAAGAAGATTCAGCCTCTG
CTTCTAATACACAAAAGGAAAAACCTGCTTCTAATATACAGAAAGAACAACCTAAGCCTCATCTCTCCAATGGAGTGGCT
GCAAGCCCTACTTCTTCAAGTCCGAGGTCTGGAGGCTTGGTTGATTATGAGGACGATGAAGATGATGAAGACTATAAACC
TCCTCCGCGGAAACAGCCAGAAGCCTCTGAGGATGAGGAAGGCGAGCTCCTGAGGCTGAAACGAAAATCCGCTCTTGTAG
AAAGAGAACAAGAGCCGTCCAAGAAACCACGGCTGGGGAAAAGTTCGAAAAGGGAAAATGTATTTGCTGTGCTATGTTCG
ACACTGAGCCATGCAGTGCTTACGGGTAAGAAAAGTCCAGGCCCCGCTGGATCAGCAGCCCGGTCAATAGTAGCGAAAGG
AGCTGAGGATTCAAAAAGTAGTGAAGAGAATAATAGCAGCAGTTCAGATGATGAGAATCATAAGGATGATGGAGTATCGA
GTTCTGAACATGAAACATCAGACAATGGAAAGCTAAATGGGGAAGAATCTCTGGTAGTAGCTCCAAAATCATCACCTGAA
ATGGCTGTAAATGGATCCTGA