Details for Arabidopsis Locus AT3G06590

Position : Chr3 ( 5`- 2052693 .. 2055414 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06590

Protein [Map View]
MASLISDIEPPTSTTSDLVRRKKRSSASSAASSRSSASSVSGEIHARWRSEKQQRIYSAKLFQALQQVRLNSSASTSSSP
TAQKRGKAVREAADRALAVSARGRTLWSRAILANRIKLKFRKQRRPRATMAIPAMTTVVSSSSNRSRKRRVSVLRLNKKS
IPDVNRKVRVLGRLVPGCGKQSVPVILEEATDYIQALEMQVRAMNSLVQLLSSYGSAPPPI*

DNA
ATGGCGTCTCTGATCTCAGATATTGAACCGCCGACGAGTACTACTTCAGATCTCGTTCGGAGAAAGAAGAGATCCTCTGC
TTCATCCGCCGCATCGTCTCGTTCAAGCGCATCTTCCGTCTCCGGTGAGATTCACGCGCGATGGCGATCGGAGAAGCAAC
AACGGATCTACTCAGCCAAACTGTTCCAAGCGCTCCAACAAGTCCGCCTCAACTCTTCCGCCTCAACATCATCATCTCCA
ACGGCTCAGAAACGAGGAAAGGCCGTCCGTGAAGCCGCCGATCGAGCTCTTGCCGTTTCCGCTCGGGGAAGAACACTCTG
GAGCAGAGCGATCTTAGCTAATCGGATCAAACTGAAATTTCGTAAACAGAGACGTCCTCGAGCTACGATGGCGATTCCGG
CCATGACTACGGTGGTTAGTAGCAGCAGCAACAGATCGAGAAAACGGAGAGTGTCGGTGTTGAGATTGAATAAGAAGAGT
ATACCGGATGTTAACCGGAAAGTACGTGTTCTAGGCCGGTTAGTTCCCGGTTGCGGTAAACAATCCGTACCGGTGATTCT
AGAAGAAGCAACTGATTATATTCAGGCTCTGGAGATGCAAGTGAGAGCCATGAACTCTTTAGTTCAGCTTCTCTCCTCCT
ACGGCTCAGCTCCTCCACCGATTTGA