Details for Arabidopsis Locus AT3G06580

Position : Chr3 ( 5`- 2048905 .. 2052025 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06580

Protein [Map View]
MAKPEEVSVPIFTSLEPVYGEGSLLQEATQRFDVLKANFNDVFGASPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDT
IIAIRKCEDQKQLRIANVNDKYTMCTYPADPDQEIDLKNHKWGHYFICAYKGFHEYAKSKGVNLGSPVGLDVLVDGIVPT
GSGLSSSAAFVCSATIAIMAVFGHNFEKKELAQLTCECERHIGTQSGGMDQAISIMAKTGFAELIDFNPVRATDVKLPDG
GSFVIAHSLAESQKAVTAAKNYNNRVVECRLASIILGVKLGMEPKEAISKVKTLSDVEGLCVSFAGDRGSSDPLLAVKEY
LKEEPYTAEEIEKILEEKLPSIVNNDPTSLAVLNAATHFKLHQRAAHVYSEARRVHGFKDTVNSNLSDEEKLKKLGDLMN
ESHYSCSVLYECSCPELEELVQVCKENGALGARLTGAGWGGCAVALVKEFDVTQFIPAVKEKYYKKRVEKGVVKKEDMEL
YLFASKPSSGAAIFNL*

DNA
ATGGCGAAACCGGAAGAAGTATCAGTCCCGATCTTCACATCTCTTGAGCCTGTCTACGGCGAAGGATCTCTGCTCCAAGA
AGCTACACAACGATTCGATGTTTTGAAGGCCAATTTCAACGATGTCTTCGGTGCTTCTCCCCAACTCTTCGCTCGCTCTC
CTGGAAGAGTGAATCTGATAGGAGAGCACATTGACTATGAAGGATACTCAGTGTTGCCGATGGCTATTCGTCAGGATACA
ATTATAGCGATTCGGAAATGTGAGGATCAAAAGCAGCTTCGGATTGCAAATGTTAATGATAAGTACACTATGTGTACATA
TCCTGCCGATCCTGACCAGGAAATTGACTTGAAGAATCACAAATGGGGGCATTACTTCATATGCGCGTACAAAGGATTTC
ATGAGTATGCAAAGTCAAAAGGTGTGAATCTTGGTTCACCAGTTGGACTTGATGTGCTTGTTGATGGAATTGTTCCTACA
GGTTCTGGGTTGTCAAGTTCTGCTGCATTTGTTTGCTCAGCAACAATTGCTATTATGGCTGTCTTTGGTCATAACTTTGA
GAAGAAAGAACTTGCACAGCTTACATGTGAATGTGAAAGACACATTGGAACACAATCTGGTGGGATGGACCAGGCAATCT
CTATAATGGCTAAAACTGGATTTGCTGAGCTTATTGACTTCAACCCAGTCCGCGCAACTGATGTGAAACTCCCTGATGGA
GGGAGTTTTGTAATTGCACATTCTCTTGCAGAGTCGCAGAAGGCGGTCACGGCTGCTAAGAATTACAATAACAGGGTCGT
TGAATGTCGACTTGCTTCGATCATACTTGGTGTTAAGCTCGGAATGGAACCAAAAGAAGCAATATCAAAAGTTAAGACTC
TTTCTGATGTGGAGGGATTATGTGTGTCATTCGCTGGTGATCGTGGGTCATCTGATCCTCTTCTTGCTGTTAAGGAATAT
CTGAAAGAAGAACCATACACGGCTGAGGAGATTGAGAAAATCCTAGAGGAGAAATTACCATCAATCGTGAACAATGATCC
AACATCTTTGGCTGTACTCAATGCTGCCACGCATTTCAAATTGCATCAGAGAGCTGCACACGTTTATTCCGAAGCCCGGA
GGGTTCATGGTTTCAAGGACACAGTTAATTCAAACTTAAGTGACGAAGAGAAGTTAAAGAAACTTGGTGATCTCATGAAT
GAAAGCCATTACAGCTGCAGTGTCCTATACGAGTGCAGTTGCCCCGAGCTAGAAGAACTTGTTCAAGTTTGCAAGGAGAA
TGGAGCACTTGGAGCAAGACTGACCGGAGCTGGATGGGGCGGTTGCGCTGTGGCCTTGGTCAAGGAATTTGACGTTACTC
AATTCATTCCAGCAGTCAAGGAGAAGTACTACAAAAAGAGAGTAGAGAAAGGAGTGGTAAAAAAAGAAGATATGGAGCTT
TACCTCTTTGCCTCCAAGCCTTCAAGTGGTGCTGCCATCTTCAACCTCTAA