Details for Arabidopsis Locus AT3G06550

Position : Chr3 ( 5`- 2039064 .. 2042959 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06550

Protein [Map View]
MASSSPVTPGLMSVVFGIVPVIVAWLYSEYLHYAKYSVSAKTRHSDVNLVEIAKDFVKEDDKALLIEDGGGLQSASPRAK
GPTTHSPLIRFVLLDESFLVENRLTLRAIIEFAVLMVYFYICDRTDVFNSSKKSYNRDLFLFLYFLLIIVSAITSFTIHT
DKSPFSGKAIMYLNRHQTEEWKGWMQVLFLMYHYFAAAEYYNAIRVFIACYVWMTGFGNFSYYYIRKDFSLARFAQMMWR
LNFLVIFSCIVLNNSYMLYYICPMHTLFTLMVYGALGIMSKYNEMGSVIAAKFFACFVVVIIVWEIPGVFEWIWSPFTLL
MGYNDPAKPQLPLLHEWHFRSGLDRYIWIIGMLYAYYHPTVESWMDKLEEAEMKFRVAIKTSVALIALTVGYFWYEYIYK
MDKLTYNKYHPYTSWIPITVYICLRNITQSFRGYSLTLLAWLGKITLETYISQFHIWLRSGVPDGQPKLLLSLVPDYPLL
NFMLTTSIYVAISYRLFELTNTLKTAFIPTKDDKRLVYNTISALIICTCLYFFSFILITIPQKLVSQNFIFLCGRKLFFP
WYLSSLIC*

DNA
ATGGCGAGTTCAAGCCCTGTTACACCTGGGCTAATGTCGGTGGTGTTCGGGATTGTGCCGGTGATCGTGGCTTGGCTATA
CTCTGAGTATCTGCACTATGCTAAATACTCGGTCTCCGCCAAAACTAGGCACTCTGATGTCAATTTGGTGGAAATTGCGA
AAGATTTTGTTAAAGAAGATGACAAAGCTCTTTTAATAGAAGATGGAGGTGGTCTCCAATCAGCTTCTCCTAGAGCCAAA
GGCCCGACCACACATTCTCCTCTCATCAGGTTTGTCCTCTTGGATGAGTCGTTCTTGGTTGAGAACAGGCTGACTTTAAG
GGCAATAATTGAGTTTGCAGTACTTATGGTATACTTTTACATATGTGACCGCACAGATGTCTTCAATTCATCAAAGAAGA
GTTACAACCGGGATCTCTTTCTGTTCCTTTACTTCCTTCTCATCATCGTTTCAGCGATAACTTCATTCACGATACATACT
GATAAATCACCATTCAGCGGAAAAGCCATCATGTACTTGAATAGGCATCAAACCGAGGAGTGGAAAGGCTGGATGCAGGT
CCTTTTCTTGATGTACCACTACTTTGCTGCTGCAGAGTACTATAATGCGATCCGTGTTTTCATTGCTTGCTATGTATGGA
TGACTGGATTTGGGAATTTTTCTTATTATTACATTCGCAAGGACTTTAGCCTTGCAAGGTTTGCACAGATGATGTGGCGG
CTAAATTTCCTGGTCATATTCTCCTGCATCGTCCTCAACAACAGTTACATGCTATACTACATCTGCCCAATGCACACTCT
GTTTACTCTAATGGTCTATGGGGCACTTGGTATTATGAGCAAGTATAATGAGATGGGTTCAGTCATAGCTGCCAAATTTT
TTGCCTGCTTCGTTGTTGTTATCATCGTTTGGGAAATTCCTGGCGTTTTTGAATGGATTTGGAGTCCATTTACACTCCTA
ATGGGTTACAATGATCCCGCAAAACCTCAGCTTCCCCTCTTGCATGAGTGGCATTTCCGCTCTGGACTTGATCGGTACAT
ATGGATAATCGGGATGCTATATGCATACTACCACCCAACTGTTGAAAGTTGGATGGATAAACTGGAGGAAGCTGAGATGA
AATTCAGGGTGGCTATCAAAACATCTGTGGCACTGATAGCACTAACGGTGGGATATTTTTGGTACGAGTATATATACAAG
ATGGACAAGTTAACTTACAACAAATATCATCCTTACACCTCTTGGATTCCAATAACTGTTTATATCTGTCTCCGGAACAT
CACCCAGTCTTTCCGCGGCTACAGTTTGACCCTTCTGGCGTGGCTTGGAAAGATAACACTGGAGACATATATCTCCCAGT
TTCATATATGGCTCAGATCTGGAGTTCCTGATGGTCAACCCAAATTACTACTATCTCTTGTCCCGGATTACCCATTGTTG
AACTTCATGCTCACTACTTCGATTTACGTCGCTATCTCTTATAGGCTCTTTGAGCTTACCAACACTTTGAAAACAGCCTT
CATACCAACCAAGGACGACAAACGCCTTGTCTACAACACGATCTCAGCACTCATAATCTGCACTTGTCTCTACTTTTTCT
CATTTATTCTTATCACAATTCCCCAAAAACTGGTAAGTCAAAATTTTATCTTTTTGTGTGGGAGAAAGCTTTTTTTTCCC
TGGTACTTGAGTTCATTGATATGTTAG