Details for Arabidopsis Locus AT3G06540

Position : Chr3 ( 5`- 2035003 .. 2037788 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06540

Protein [Map View]
MIDIPPYPPLDPSNYDLIVVGTGVSESVLAAAASSSGSSVLHLDPNPFYGSHFASLSLPDLTSFLHSNSVSPPPSPSSPP
LPPSNNHDFISVDLVNRSLYSSVEISSFESEILEEHSRRFNVDLAGPRVVFCADESINLMLKSGANNYVEFKSIDASFVG
DSSGELRNVPDSRAAIFKDKSLTLLEKNQLMKFFKLVQSHLASSTEKDDSTTVKISEEDMESPFVDFLSKMRLPPKIKSI
ILYAIAMLDYDQDNTETCRHLLKTKEGIDRLALYITSMGRFSNALGALIYPIYGQGELPQAFCRRAAVKGCIYVLRMPIT
ALLLDKETGGYKGVRLASGQEIFSQKLILDPCVTVGLESLSSLTDQQNETLSVLVPKSMINKEKIARGVCVIRGSVKANV
SNALVVYPPKSLFPEQLTAIRVLQLGSGLAVCPADMHVLYLSTLCDNDDQGIKALLSAMSNLISLPVPENRQSDSVVEND
TSETKPILLWRALYVQELVKGEFGGTISSMPSPDGNLNYNEIVESAVKLYEKLMGSEELFKEETSPAENTTEEENDGGVE
IED*

DNA
ATGATCGACATCCCTCCTTACCCGCCGCTTGATCCTTCCAACTACGATCTCATTGTCGTCGGCACCGGAGTCTCTGAGTC
CGTCTTAGCCGCCGCTGCTTCCTCCTCCGGTAGTTCTGTTCTCCACCTCGACCCTAACCCCTTCTACGGCTCTCACTTCG
CCTCTCTTTCCCTTCCCGATCTCACTTCTTTCCTTCACTCAAACTCCGTTTCTCCTCCTCCGTCGCCGTCATCTCCTCCT
CTCCCTCCGTCAAACAACCATGATTTTATCTCCGTGGATCTCGTTAACCGATCCTTGTATTCCTCCGTGGAGATTTCGAG
CTTCGAATCGGAGATCCTCGAAGAACACTCTAGAAGATTCAACGTTGACTTGGCTGGTCCTAGGGTTGTCTTCTGTGCCG
ATGAATCAATTAATCTCATGCTGAAATCAGGAGCTAACAACTACGTTGAGTTCAAGAGCATCGATGCCAGCTTCGTTGGG
GATTCGAGCGGTGAGCTACGAAATGTGCCGGATTCGAGAGCTGCTATATTCAAGGACAAGAGCTTGACTCTGTTGGAGAA
GAATCAGCTCATGAAATTCTTCAAGCTTGTTCAAAGTCACTTGGCTTCTTCTACCGAAAAAGATGATTCAACAACAGTCA
AGATATCGGAGGAAGATATGGAGAGTCCATTTGTGGACTTCTTGTCAAAGATGCGTTTACCACCCAAAATCAAATCGATC
ATCTTGTATGCCATTGCGATGCTAGATTATGATCAAGACAATACGGAAACTTGTAGACATTTACTCAAGACCAAAGAGGG
GATAGATCGATTGGCTCTATACATCACATCTATGGGCAGGTTTTCTAACGCACTTGGGGCGTTGATATACCCAATTTATG
GACAAGGAGAACTTCCACAAGCCTTTTGTCGTCGGGCTGCTGTCAAAGGATGTATCTATGTTCTCCGGATGCCTATTACT
GCTCTGCTTTTAGACAAGGAAACTGGGGGTTACAAAGGGGTTAGATTAGCTTCTGGTCAAGAGATATTCAGCCAAAAGTT
GATTCTGGATCCATGTGTTACTGTTGGATTAGAGTCTCTGTCGTCATTGACAGATCAGCAAAATGAAACTCTCAGTGTTC
TTGTCCCAAAGTCGATGATCAATAAGGAGAAAATTGCAAGAGGAGTATGCGTCATTAGAGGTTCTGTGAAAGCTAATGTA
TCAAACGCTCTTGTCGTTTATCCACCTAAATCTTTGTTTCCAGAACAGCTAACTGCAATTCGGGTTCTGCAGCTTGGTAG
TGGTTTAGCGGTTTGTCCTGCTGACATGCATGTTTTATATCTTTCAACTTTGTGCGACAATGATGACCAAGGGATAAAGG
CGCTATTATCAGCCATGAGTAATCTCATCAGTTTGCCTGTTCCCGAGAATCGTCAAAGCGATTCCGTTGTTGAGAATGAT
ACTTCTGAGACAAAACCTATTCTACTCTGGAGAGCACTGTACGTGCAAGAGCTAGTCAAGGGTGAATTTGGAGGTACGAT
CAGTTCCATGCCTAGTCCAGATGGAAACTTGAACTACAATGAGATAGTGGAATCAGCCGTGAAGCTATATGAAAAGCTCA
TGGGGAGTGAAGAATTATTTAAAGAAGAGACCTCACCGGCGGAGAACACAACGGAGGAGGAAAACGATGGTGGTGTTGAA
ATAGAAGATTGA