Details for Arabidopsis Locus AT3G06530

Position : Chr3 ( 5`- 2022433 .. 2033791 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06530

Protein [Map View]
MSSSIVSQLQALKSVLQADTEPSKRPFTRPSILFSPKEAADFDIESIYELGLKGLEVLGNKDERFKNYMNDLFSHKSKEI
DRELLGKEENARIDSSISSYLRLLSGYLQFRASLETLEYLIRRYKIHIYNLEDVVLCALPYHDTHAFVRIVQLLSTGNSK
WKFLDGVKNSGAPPPRSVIVQQCIRDKQVLEALCDYASRTKKYQPSKPVVSFSTAVVVGVLGSVPTVDGDIVKTILPFVD
SGLQSGVKGCLDQQAGALMVVGMLANRAVLNTNLIKRLMRSIIDIGREHAKESSDPHSLRLSLMALINFVQLQSVDLIPR
KALDLFNEIRDISGVLLGLSKEFNIKRFLAVLLDSLLFYSSSDDKCCEVLASIIETVPVSNLVDHLISKVFSLCMTQYQK
NSDFRSSTSVVGSWAKKFLVVVSKKYPAELRAAVPKFLEATEVQSKKEDLKLEMLSCMLDGNSDMSHPFVDSKLWFRLHH
PRAAVRCAALSSLNGVLKDDSSKAENLVTIQDAILRQLWDDDLAVVQAALSFDKLPNIITSSGLLDALLHVVKRCVGILV
SGVSHNVQLAVDVVALSLKIAVSSFGNQTDSTEKVTSAMFPFLLIQPKTWNLNLLVLKLGKDVNWPLFKNLAADDGMKKL
PDIMSTNLSSISMDIINDLGEALSLDPDERRIELIERACNYKLSEVLETCSNIKCSEQDRNKLQKGLLIRESVSALNIDV
INKLVEAFMMHPADYIQWLTVSCRDSTLSKTLFYMILMHSLQKMNSSSGKLLSITEWEELEVEVDVSLKELSKSNCQELL
YQLLDTSDFTALNSKVLICLFWKLGESFIKLEPAHDASVLNKRLSSGLEDLFFFFATTRLRHVFKEHLHFRVREAKVCPV
LFLSRLISREDVPPLVQIESLRCFSYLCSSGNNEWLIQVFSSFPVLLVPMSSDNQDVKAAAINCIEALFNLRCRVESSKK
NGSAAIYGSSFDELLGMIVQQRRLILSDNKFFASYLTSLLSSTTNDLLVPVGLQKRFDQSTKENILSVILLCAEDLPAYG
KLRVLSLLKDLGIMLMRDEIVKLLSQLLDKRSQYYYKLDKTSQPLSDTEVDLLCLLLECSMMRTSSFKGQSLDDHILSAL
NVDCMASERPAVISPCLTILEKLSNRFYDELQTDVQIRFFHKLVSMFRSSNGSIQNGAKEAVLRLKLSSSTVVLALDRIT
QQDTLVIGSLSKKKKQKKNSKSCPEEDINSEEFRSGEKALSFIASLLDMLLLKKDLTHRESLIRPLFKLLQRSMSKEWVK
IAFSIEETSLQPPQDVRETTPTFISSIQQTLLLILKDIFDSLNMNPLKAEVANEINVKMLVELAHSSNDGVTRNHIFSLF
TAIVKFVPDKVLDHIISILTLVGESTVTQIDSHSKSIFEGFISMVIPFWLSKTKSEEQLLQIFVKVLPDIVEHRRRSIVA
YLLGVIGERNGLPALLVLLFKSLISRKDSAWLGNANVSESFASIVKKEWEYSFAMEICEQYSSSTWLSSLVILLQTISKD
SKQCFLQMRLVLEFVFQKLQDPEFAFAVSLEPRNNVSVGIQQELQELMKCCICLLQAIDAKKEKDVTSSVRNEIRMRIHD
VLMTVTGAMDLSIYFRVVTSLLQQQTDYNGTKKVLGLISERAKDTSSSKMKHKRKISNQKGRNSWLNLDEVAVDSFGKMC
EEIVHLINATDDESGVPVKRAAISTLEVLAGRFPSGHPIFRKCLAAVAECISSKNLGVSSSCLRTTGALINVLGPKALIE
LPCIMKNLVKQSLEVSFASQSGRNATAEEQLLMLSVLVTLEAVIDKLGGFLNPHLGDIMKIMVLHPEYVSDFDKNLKSKA
NAIRRLLTDKIPVRLTLQPLLRIYNEAVSSGNASLVIAFNMLEDLVVKMDRSSIVSSHGKIFDQCLVALDIRRLNPAAIQ
NIDDAERSVTSAMVALTKKLTESEFRPLFIRSIDWAESDVVDGSGSENKSIDRAISFYGLVDRLCESHRSIFVPYFKYVL
DGIVAHLTTAEASVSTRKKKKAKIQQTSDSIQPKSWHLRALVLSCLKNCFLHDTGSLKFLDTNNFQVLLKPIVSQLVVEP
PSSLKEHPHVPSVDEVDDLLVSCIGQMAVASGSDLLWKPLNHEVLMQTRSESVRSRMLSLRSVKQMLDNLKEEYLVLLAE
TIPFLAELLEDVELSVKSLAQDIIKQMEEMSGESLAEYL*

DNA
ATGAGTTCTTCAATAGTGTCACAGTTACAGGCTCTCAAGTCAGTGTTACAAGCCGATACAGAGCCTTCCAAGAGACCTTT
CACACGCCCTTCGATTCTCTTCAGTCCTAAAGAAGCAGCTGATTTCGATATCGAATCAATTTACGAGCTCGGGCTCAAAG
GTCTAGAAGTACTTGGAAACAAAGATGAGAGGTTTAAAAATTACATGAACGACTTGTTTAGTCATAAAAGTAAAGAAATT
GATAGGGAATTGCTGGGTAAAGAAGAAAATGCTCGGATTGATTCATCAATCAGTTCGTATCTACGTTTACTCTCTGGTTA
TCTTCAATTTCGTGCTTCCTTGGAGACCCTTGAGTATCTCATACGACGATACAAGATTCATATATACAACTTGGAAGATG
TGGTTCTATGCGCCTTGCCATACCATGACACACATGCCTTTGTCCGCATTGTTCAACTGCTTTCTACTGGAAATTCCAAG
TGGAAATTTCTGGATGGTGTTAAAAATTCAGGTGCTCCACCTCCTAGATCGGTTATCGTTCAGCAATGTATACGTGATAA
ACAAGTTTTGGAGGCCTTGTGTGACTATGCATCTCGTACTAAGAAGTATCAGCCTTCAAAACCTGTGGTTAGCTTCTCCA
CCGCAGTTGTTGTTGGGGTGCTCGGTTCAGTTCCAACTGTTGATGGAGATATTGTAAAGACGATTTTGCCATTTGTGGAC
TCTGGTCTTCAATCTGGTGTGAAAGGATGTTTAGATCAACAGGCTGGAGCGTTAATGGTTGTTGGCATGTTGGCAAACAG
AGCTGTGCTAAATACTAATCTTATCAAGCGCTTGATGAGGTCCATCATCGACATTGGTCGTGAACATGCCAAGGAATCTT
CTGACCCGCATTCGCTTCGATTGTCACTTATGGCCTTGATCAATTTTGTTCAGCTGCAATCTGTGGACTTGATCCCAAGG
AAAGCATTGGATCTTTTTAACGAAATAAGAGATATTTCTGGTGTTCTTTTAGGCTTGTCCAAAGAGTTCAACATCAAAAG
ATTCCTGGCAGTGCTACTGGATTCTTTACTTTTTTACAGTTCGTCTGATGATAAATGCTGCGAAGTTTTAGCTTCAATAA
TTGAGACTGTTCCCGTAAGCAATTTGGTTGATCATTTGATCTCCAAGGTTTTCTCTTTATGTATGACACAATACCAGAAG
AACAGTGATTTTAGATCTTCTACATCTGTTGTAGGAAGCTGGGCCAAGAAATTTCTGGTTGTTGTAAGCAAGAAGTATCC
TGCTGAACTACGTGCCGCAGTTCCTAAATTTTTAGAGGCTACTGAAGTTCAGTCGAAGAAAGAGGATTTAAAGCTAGAGA
TGTTGTCTTGTATGCTGGATGGGAATTCAGACATGTCTCACCCGTTTGTGGATTCAAAATTGTGGTTCCGGCTCCACCAT
CCCAGGGCTGCTGTACGTTGTGCCGCGCTTTCTAGTCTAAATGGTGTTCTCAAGGATGATAGCTCTAAAGCAGAGAACCT
TGTCACAATTCAGGATGCTATACTGCGTCAGCTTTGGGATGATGATCTGGCTGTTGTTCAGGCTGCCCTCTCTTTCGATA
AGTTGCCCAATATAATAACCTCTTCTGGTCTTCTGGATGCTTTGCTTCATGTGGTGAAACGATGTGTTGGCATTCTCGTA
TCAGGAGTATCACATAATGTTCAACTGGCAGTTGATGTTGTTGCTTTGTCTCTTAAAATTGCTGTCTCAAGCTTCGGTAA
TCAAACAGACTCTACTGAGAAAGTTACCTCTGCAATGTTCCCATTTCTCTTAATTCAGCCGAAGACGTGGAATTTAAATC
TACTTGTGCTAAAGTTGGGAAAGGATGTTAACTGGCCACTTTTCAAGAATCTTGCTGCTGATGATGGAATGAAAAAGCTC
CCCGATATCATGTCTACAAACTTATCCTCAATTAGCATGGATATTATTAACGATTTGGGAGAAGCACTCTCCTTGGATCC
TGATGAGCGTAGGATTGAGCTTATTGAGAGAGCGTGCAACTATAAGCTCTCTGAAGTTTTGGAAACATGCAGCAATATCA
AATGTTCAGAACAGGATCGTAACAAGTTGCAGAAGGGACTACTGATCCGTGAAAGTGTGTCCGCATTGAACATAGATGTC
ATTAACAAGCTGGTGGAAGCATTTATGATGCACCCTGCTGATTATATTCAGTGGCTTACTGTCAGTTGCCGAGATTCCAC
CTTGTCAAAGACACTGTTTTATATGATTTTGATGCATTCCCTGCAGAAGATGAATTCTTCATCTGGTAAGCTTCTGTCCA
TAACTGAGTGGGAAGAACTTGAGGTCGAGGTTGATGTTTCTCTGAAAGAGCTGTCGAAAAGCAACTGCCAAGAACTCCTA
TATCAACTCCTTGATACCTCTGATTTTACTGCTCTGAATTCGAAGGTTCTGATATGCTTGTTTTGGAAGTTGGGCGAGTC
ATTCATTAAACTTGAACCTGCCCACGATGCTTCGGTTTTGAACAAAAGGTTATCTAGCGGACTTGAGGATTTGTTTTTCT
TTTTTGCAACAACTCGGTTGCGGCATGTCTTCAAGGAACACCTTCATTTCCGTGTGAGAGAAGCCAAAGTCTGTCCTGTT
TTGTTTCTATCCCGACTGATCTCACGAGAAGATGTTCCTCCTCTTGTCCAAATTGAAAGTCTCAGATGTTTTTCGTATCT
TTGCTCTAGCGGGAATAATGAATGGTTGATTCAAGTTTTTTCAAGCTTTCCTGTACTTTTGGTTCCCATGTCAAGTGATA
ATCAGGACGTTAAAGCAGCTGCCATTAATTGTATCGAGGCACTCTTCAACCTTCGGTGTCGTGTCGAATCTAGCAAAAAA
AATGGGAGTGCTGCAATCTACGGTAGTTCTTTTGATGAACTTTTGGGAATGATCGTGCAACAAAGGAGGCTTATATTGTC
AGACAATAAGTTTTTCGCATCGTACTTGACATCGTTGCTCAGTTCAACCACTAATGACCTTCTAGTGCCAGTTGGCCTGC
AAAAAAGGTTTGATCAATCCACAAAAGAAAACATTCTTTCGGTCATTTTATTGTGTGCGGAAGACCTACCTGCTTATGGG
AAGCTAAGAGTCCTATCTTTGCTAAAAGATCTGGGCATCATGCTTATGCGTGATGAAATTGTTAAGTTATTGTCTCAACT
TCTTGATAAACGTAGTCAATACTACTATAAGCTGGACAAAACTTCCCAGCCATTATCAGACACTGAGGTCGATTTATTAT
GCCTTCTTCTGGAGTGCTCCATGATGCGAACATCATCGTTTAAAGGGCAGTCTCTTGATGATCATATACTGAGCGCATTG
AATGTGGATTGTATGGCTTCAGAACGTCCTGCTGTTATTTCTCCTTGTCTTACCATTTTGGAGAAGCTAAGCAATCGATT
TTATGATGAACTGCAGACTGATGTTCAGATTCGTTTCTTCCACAAACTTGTGTCTATGTTTCGAAGTTCAAATGGCAGTA
TACAAAATGGTGCCAAAGAAGCTGTCTTACGCCTGAAGCTTTCTTCTTCAACGGTGGTCCTTGCTCTTGATCGTATCACT
CAGCAGGATACTCTTGTTATTGGTTCTTTGAGCAAGAAGAAGAAACAGAAGAAAAATTCAAAGTCATGTCCAGAAGAAGA
CATAAATAGCGAGGAATTTCGAAGTGGGGAAAAGGCTCTCTCTTTCATTGCCTCATTACTTGACATGCTGCTTCTCAAGA
AAGATCTAACTCACAGGGAGTCCCTCATAAGGCCCTTGTTTAAGCTCCTACAAAGATCCATGTCTAAAGAATGGGTGAAA
ATTGCTTTTTCAATTGAGGAAACGTCACTCCAGCCTCCACAGGATGTTCGTGAAACAACTCCTACCTTTATTTCTTCCAT
CCAACAGACTCTGCTCTTAATCCTGAAAGATATTTTTGATTCTCTGAATATGAATCCTTTGAAGGCTGAAGTAGCAAATG
AAATCAATGTCAAAATGCTGGTTGAGTTGGCTCATTCATCAAATGATGGAGTCACACGGAACCATATCTTCTCCTTGTTC
ACTGCAATTGTTAAATTTGTCCCTGATAAGGTTTTGGACCATATTATCAGCATACTTACACTTGTTGGTGAATCAACTGT
GACACAGATTGATAGTCACTCGAAGTCTATCTTTGAGGGGTTTATATCAATGGTCATTCCATTTTGGCTGTCTAAGACTA
AGAGTGAGGAGCAGTTGTTACAGATTTTTGTGAAAGTCTTACCTGATATTGTTGAGCATAGAAGGCGTTCAATTGTAGCT
TACTTGCTGGGAGTTATCGGTGAACGAAATGGCTTGCCTGCTTTGCTTGTCCTCTTATTTAAGTCTTTGATTTCAAGAAA
AGACTCAGCTTGGCTTGGTAATGCCAACGTTTCTGAAAGTTTTGCTTCCATTGTTAAAAAAGAATGGGAGTATTCTTTTG
CCATGGAAATATGTGAACAATATTCTTCTTCGACGTGGCTCTCATCCTTGGTCATACTTCTTCAAACTATCAGCAAAGAC
AGTAAACAATGTTTCTTACAGATGCGGCTTGTATTAGAATTTGTATTCCAGAAATTGCAAGACCCGGAATTTGCATTTGC
AGTCTCACTGGAACCAAGAAATAATGTTTCTGTTGGCATCCAGCAAGAACTACAAGAGCTTATGAAGTGTTGTATATGTC
TCCTGCAAGCTATTGATGCGAAAAAGGAGAAAGATGTGACTTCTTCAGTTAGAAATGAAATCAGAATGCGTATACATGAT
GTCTTAATGACTGTTACGGGAGCCATGGATCTGTCTATATATTTCAGGGTTGTTACTAGCTTGCTTCAGCAGCAGACAGA
TTATAATGGGACGAAAAAGGTACTTGGACTTATAAGTGAGAGAGCTAAGGACACCTCATCTTCTAAAATGAAACACAAGA
GAAAGATTTCCAATCAAAAAGGAAGAAATTCTTGGTTGAACTTGGATGAGGTTGCTGTTGATTCTTTCGGGAAGATGTGT
GAGGAGATTGTCCATCTGATTAATGCGACAGATGATGAGTCAGGTGTTCCAGTAAAACGAGCTGCCATTTCTACACTGGA
AGTTTTGGCTGGCAGGTTTCCATCTGGTCATCCAATCTTCAGGAAATGCCTTGCAGCTGTTGCAGAATGCATCAGTTCAA
AGAATTTGGGAGTCTCGTCCAGCTGTCTTCGAACAACTGGTGCACTGATCAATGTTCTTGGACCAAAGGCGCTCATTGAA
CTTCCATGCATAATGAAGAATTTGGTAAAACAGTCGCTTGAAGTATCATTTGCATCCCAGAGTGGTCGAAACGCAACAGC
TGAAGAACAGTTGCTTATGCTGTCTGTTCTAGTCACTTTGGAAGCAGTGATTGATAAACTTGGAGGTTTCCTAAATCCTC
ATCTTGGAGATATTATGAAAATCATGGTGCTACATCCTGAATATGTATCTGACTTCGACAAGAATCTCAAGTCCAAAGCC
AATGCCATTAGGAGGCTCCTTACTGATAAAATACCTGTTCGTCTCACTCTGCAACCACTTCTACGAATATACAATGAGGC
TGTTAGTTCTGGGAATGCAAGCTTGGTGATTGCTTTTAATATGTTAGAAGATCTGGTTGTGAAAATGGATAGATCATCTA
TCGTTAGCAGCCATGGGAAGATTTTTGATCAGTGCTTAGTTGCCCTTGATATTCGACGTCTAAATCCAGCAGCAATTCAG
AACATTGATGATGCTGAGAGAAGTGTAACTAGCGCAATGGTTGCTCTCACAAAGAAGCTAACGGAGTCCGAGTTCAGACC
TCTCTTTATTAGGAGTATTGATTGGGCAGAGTCAGATGTTGTTGACGGATCAGGGAGTGAAAACAAGAGCATCGACCGAG
CTATATCTTTCTATGGTCTGGTGGATCGACTCTGTGAGAGTCACAGGTCCATCTTTGTACCGTATTTCAAATACGTGCTT
GATGGTATTGTAGCACATCTCACCACTGCTGAAGCTTCTGTTTCAACTAGGAAGAAAAAGAAAGCCAAAATTCAGCAAAC
TTCTGACTCTATACAACCAAAAAGCTGGCATCTTAGGGCATTAGTTCTTTCTTGCTTGAAGAATTGTTTTCTGCATGATA
CCGGCAGCTTGAAGTTTCTGGATACAAATAACTTCCAGGTGCTACTTAAGCCTATTGTATCACAGCTTGTTGTTGAACCT
CCATCTTCTTTAAAGGAGCACCCACATGTACCATCTGTGGATGAGGTTGATGATTTATTGGTTTCATGCATCGGTCAAAT
GGCAGTAGCCTCAGGCTCTGACCTCCTCTGGAAACCGCTGAACCACGAGGTGCTAATGCAAACGAGGAGTGAGAGTGTAC
GGTCAAGGATGTTGAGTTTGAGAAGTGTGAAACAGATGCTGGATAATCTGAAAGAAGAGTATCTTGTGTTGCTTGCTGAA
ACCATTCCATTCTTGGCTGAGCTACTAGAAGACGTCGAGCTATCTGTTAAATCTTTGGCTCAAGATATTATCAAACAAAT
GGAAGAGATGAGCGGTGAAAGTCTGGCGGAATACCTCTGA