Details for Arabidopsis Locus AT3G06510

Position : Chr3 ( 5`- 2016330 .. 2019778 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06510

Protein [Map View]
MELFALLIKVAGLLATVTVGANVVSYSRFRRQNLAKFRSPIDESKEVLADFNSIEHEEGKFFFGLATAPAHAEDDLDDAW
LQFAKETPCSAEEAEAADKKARRKKVKLAVGAITKGLAKNTHGKEDKNAADKPPSKNVAAWHNAPHAEDRLKFWSDPDKE
VKLAKDTGVTVFRMGVDWSRIMPVEPTKGIKEAVNYEAVEHYKWILKKVRSNGMKVMLTLFHHSLPPWAADYGGWKMEKT
VDYFMDFTRIVVDSMYDLVDSWVTFNEPHIFTMLTYMCGSWPGNNPDFLEIATSTLPMGVFHRALHWMAVAHSKAYDYIH
GKISLKKPLVGVAHHVSFMRPYGLFDIGAVTISNSLTIFPYIDSICEKLDFIGINYYGQVRELQVKIAIRSQILINNIAF
SRISMLESDSRNQEAVCGAGLKLVETDEYSESGRGVYPDGLYRVLLMFHERYKHLKVPFIVTENGVSDETDVIRRPYLIE
HLLALYAAMLKGVPVLGYIFWTISDNWEWADGYGPKFGLVAVDRSHDLARTLRQSYHLFSKIVKSGKVTRKDRSLAWNEL
QKAAKAGKLRPFYRGVDNHNLMYADGLDKPQWRPFVDRDWRFGHYQMDGLQDPLSRVARTLLIWPLIMKKRIRKVKIKHT
DDAGLVLHPALASPFD*

DNA
ATGGAATTATTCGCATTGTTAATTAAGGTCGCCGGACTTTTGGCCACTGTCACCGTTGGAGCCAACGTAGTTTCCTACTC
TCGTTTCCGTCGCCAGAATCTCGCGAAGTTTCGCTCTCCAATCGACGAATCTAAAGAAGTTCTCGCTGATTTCAATTCCA
TTGAACACGAGGAAGGAAAATTCTTCTTTGGGTTAGCTACTGCACCTGCTCATGCGGAGGATGATTTAGATGATGCTTGG
CTCCAGTTTGCTAAAGAAACACCATGTTCAGCAGAAGAAGCAGAGGCTGCTGATAAGAAAGCTAGGAGGAAGAAGGTTAA
GCTTGCTGTGGGAGCTATAACCAAAGGCTTGGCCAAGAACACTCATGGCAAAGAAGATAAGAATGCAGCTGATAAGCCAC
CCTCTAAAAATGTTGCCGCGTGGCATAACGCTCCTCACGCGGAGGACAGGCTTAAATTTTGGTCAGATCCTGACAAAGAA
GTGAAGCTAGCCAAAGATACTGGCGTTACTGTCTTTAGGATGGGAGTCGATTGGTCTAGGATCATGCCAGTTGAGCCCAC
CAAAGGAATTAAGGAAGCAGTTAACTATGAGGCTGTCGAACACTATAAATGGATACTTAAAAAAGTTCGTTCAAATGGAA
TGAAGGTGATGCTAACGCTGTTTCATCATTCATTGCCACCATGGGCAGCTGACTATGGTGGCTGGAAAATGGAGAAGACA
GTCGACTACTTTATGGACTTTACCAGGATTGTTGTGGATTCCATGTATGATTTGGTAGACTCTTGGGTAACATTTAATGA
ACCCCATATCTTCACCATGCTTACCTACATGTGTGGATCTTGGCCCGGTAACAACCCTGATTTTCTGGAGATAGCTACAT
CTACTCTACCAATGGGTGTATTCCATCGAGCCTTACACTGGATGGCTGTTGCTCACTCAAAGGCCTATGACTACATCCAT
GGGAAAATTTCTTTGAAAAAACCTTTGGTAGGGGTTGCGCACCACGTCTCCTTTATGCGACCATATGGGCTCTTTGATAT
CGGGGCTGTTACCATTAGTAATTCCCTCACTATATTTCCATATATCGATAGCATTTGTGAGAAGTTGGATTTCATAGGCA
TCAACTACTACGGACAGGTAAGAGAGCTACAAGTAAAAATTGCTATTAGGTCTCAAATTTTGATTAATAATATTGCTTTC
TCTCGAATAAGTATGTTGGAATCTGACTCGAGAAATCAGGAAGCAGTGTGTGGTGCTGGACTAAAGCTTGTAGAGACTGA
TGAATACAGTGAATCGGGAAGAGGGGTATATCCTGATGGTCTCTACCGCGTGTTGTTGATGTTCCACGAGAGATACAAAC
ACCTGAAAGTTCCTTTTATCGTCACAGAAAATGGCGTGTCTGATGAAACAGATGTGATTCGACGACCTTACCTGATCGAG
CATCTCCTTGCCTTATATGCTGCAATGCTAAAGGGTGTTCCTGTGCTCGGTTACATATTCTGGACTATTTCGGACAATTG
GGAATGGGCTGATGGATATGGTCCAAAATTTGGACTTGTTGCGGTTGACCGATCCCATGATCTTGCCCGAACTCTTCGGC
AATCATACCATCTCTTTTCCAAGATAGTTAAAAGTGGAAAAGTCACTCGGAAAGATCGGTCTCTTGCATGGAACGAACTC
CAAAAAGCTGCCAAAGCAGGAAAACTACGGCCATTCTACCGAGGCGTTGATAATCATAATCTTATGTACGCAGATGGTCT
CGACAAGCCTCAATGGAGACCGTTTGTTGACCGCGACTGGCGGTTTGGTCACTACCAAATGGATGGTCTTCAAGACCCGT
TGAGTCGCGTGGCTCGAACCCTTCTCATATGGCCGCTTATCATGAAAAAGAGGATAAGAAAAGTTAAGATCAAGCACACC
GATGATGCTGGGCTTGTTCTACATCCTGCTTTAGCCTCACCCTTTGACTAG