Details for Arabidopsis Locus AT3G06490

Position : Chr3 ( 5`- 2003393 .. 2006624 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06490

Protein [Map View]
MDEKGRSLKNNNMEDEMDLKRGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVRRGNITLE
EQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQSASASSAA
AATTTTTTTTGSAGTSSCITTSNNQFMNYDYNNNNMGQQFGVMSNNDYITPENSSVAVSPASDLTEYYSAPNPNPEYYSG
QMGNSYYPDQNLVSSQLLPDNYFDYSGLLDEDLTAMQEQSNLSWFENINGAASSSDSLWNIGETDEEFWFLQQQQQFNNN
GSF*

DNA
ATGGATGAAAAAGGAAGAAGCTTGAAGAACAACAACATGGAAGACGAGATGGACCTAAAGAGAGGTCCGTGGACTGCTGA
AGAAGATTTTAAGCTCATGAATTACATTGCTACTAATGGAGAAGGTCGCTGGAACTCTCTTTCTCGTTGCGCCGGCCTCC
AACGCACCGGTAAAAGCTGTAGACTAAGGTGGTTAAACTATCTCCGCCCTGACGTCCGCCGTGGAAACATTACACTTGAA
GAACAACTCTTGATCCTCGAACTTCATTCCCGTTGGGGAAATAGATGGTCAAAAATCGCACAATATTTACCGGGAAGAAC
GGACAACGAGATCAAGAACTACTGGAGGACGCGGGTGCAAAAGCATGCGAAACAGTTGAAATGTGATGTGAATAGCCAAC
AATTCAAAGACACAATGAAGTACTTGTGGATGCCTCGACTAGTCGAGAGGATTCAGTCAGCCTCGGCCTCATCCGCAGCA
GCAGCCACCACCACAACCACCACCACCACAGGATCAGCCGGCACGTCATCTTGCATCACAACCTCTAACAATCAATTCAT
GAATTACGACTACAACAACAACAACATGGGACAACAGTTTGGTGTAATGAGCAACAATGATTATATCACGCCTGAAAATT
CCAGCGTGGCAGTGTCTCCGGCGTCAGACTTAACGGAGTACTACAGCGCTCCAAACCCTAACCCGGAATACTATTCGGGT
CAAATGGGGAATAGTTATTATCCAGATCAGAATTTAGTGAGTTCACAATTATTACCGGATAATTATTTCGACTATAGTGG
ATTATTAGACGAAGATCTAACGGCTATGCAAGAGCAGAGTAACCTCAGCTGGTTTGAAAACATTAATGGTGCTGCTTCTT
CTTCAGACAGTTTATGGAACATTGGAGAAACTGATGAAGAATTCTGGTTCTTACAGCAGCAACAACAGTTCAACAATAAT
GGTAGCTTCTGA