Details for Arabidopsis Locus AT3G06435

Position : Chr3 ( 5`- 1969121 .. 1970784 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06435

Protein [Map View]
MAKKSKRNQNNKGKTKIPQRVEVFGVNDPVTRFGWTIMAFLCVFGAVGAVNALEIQMDVSYLVMFVVAIYVIPVLHSIFS
EAPSPVYRAHRWVRTVIPLILLTIIYFTVFNFQTLAASVLIISVVFGIFVLVQLVFPVERFYFFYVVLILLFGCCSAVFA
GQYDPKTQPFGFCLLTLFVFEMFFYFFYYPGPTNRAFKFY*

DNA
ATGGCCAAAAAATCTAAGCGAAACCAAAATAATAAAGGAAAGACGAAGATTCCCCAGAGAGTTGAAGTGTTTGGTGTGAA
TGATCCAGTAACCAGATTTGGTTGGACTATCATGGCTTTTCTCTGCGTTTTTGGAGCTGTGGGTGCTGTGAATGCCTTGG
AGATCCAGATGGATGTCTCTTATCTGGTAATGTTTGTTGTAGCTATCTATGTGATTCCAGTCTTGCATTCCATTTTCTCT
GAAGCTCCATCTCCAGTTTACAGAGCACATCGATGGGTGAGAACTGTTATCCCTCTCATACTGCTTACCATAATCTACTT
TACTGTCTTCAATTTCCAAACCCTTGCAGCATCTGTTTTGATCATATCAGTGGTTTTTGGAATTTTCGTGTTGGTTCAGT
TGGTTTTCCCTGTAGAAAGATTTTACTTTTTTTATGTAGTGCTCATTTTGTTATTTGGATGCTGCTCAGCTGTATTTGCT
GGTCAGTATGATCCCAAAACCCAGCCATTTGGGTTCTGCCTATTAACTCTCTTTGTTTTTGAAATGTTTTTCTACTTTTT
CTACTATCCTGGGCCTACTAATAGGGCATTCAAATTCTATTAG