Details for Arabidopsis Locus AT3G06430

Position : Chr3 ( 5`- 1956409 .. 1958299 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06430

Protein [Map View]
MASMSLSFSSSLCSSRIPEGKRRFRHRDVGIVRCVLAASKSSPGSVTKKRLWKDGEFPGITEPVNQRRTPIKNVKKKLDR
RSKANGWVNTVTETLSDLIAKKQWLQALEVFDMLREQTFYQPKEGTYMKLLVLLGKSGQPNRAQKLFDEMLEEGLEPTVE
LYTALLAAYTRSNLIDDAFSILDKMKSFPQCQPDVFTYSTLLKACVDASQFDLVDSLYKEMDERLITPNTVTQNIVLSGY
GRVGRFDQMEKVLSDMLVSTACKPDVWTMNIILSVFGNMGKIDMMESWYEKFRNFGIEPETRTFNILIGSYGKKRMYDKM
SSVMEYMRKLEFPWTTSTYNNIIEAFADVGDAKNMELTFDQMRSEGMKADTKTFCCLINGYANAGLFHKVISSVQLAAKF
EIPENTAFYNAVISACAKADDLIEMERVYIRMKERQCVCDSRTFEIMVEAYEKEGMNDKIYYLEQERQKLMDRTVATKEM
ENLPAG*

DNA
ATGGCGTCAATGTCTCTCTCCTTTTCTTCTTCGCTATGTTCATCCAGAATCCCCGAAGGTAAGCGTAGGTTTCGTCACAG
AGATGTGGGCATCGTTAGATGCGTTTTGGCTGCTTCGAAATCTTCTCCGGGAAGTGTTACGAAGAAGAGGCTTTGGAAAG
ACGGCGAATTCCCCGGAATCACGGAGCCGGTTAATCAGAGAAGAACTCCGATAAAGAATGTGAAGAAGAAACTTGACAGG
AGAAGCAAAGCTAACGGATGGGTTAACACCGTCACTGAAACTTTGTCCGATCTCATCGCCAAAAAGCAGTGGTTACAAGC
TCTCGAGGTTTTTGATATGTTGAGGGAACAAACATTTTATCAACCAAAGGAAGGAACTTACATGAAGCTGCTTGTTCTTC
TCGGTAAATCTGGTCAACCCAATCGTGCACAGAAGCTGTTCGACGAAATGCTTGAAGAAGGACTTGAACCAACTGTTGAA
CTCTACACTGCTCTTCTCGCTGCTTACACTCGCAGCAATCTCATCGACGATGCTTTTTCAATTCTTGATAAAATGAAAAG
CTTTCCTCAATGCCAACCTGATGTTTTCACGTACAGCACTCTGCTCAAGGCTTGTGTGGATGCTTCTCAGTTTGACTTGG
TGGATTCGTTATACAAGGAAATGGACGAGCGTTTGATAACTCCAAACACTGTGACCCAGAACATAGTTTTAAGTGGGTAC
GGTAGGGTCGGAAGGTTTGATCAGATGGAGAAAGTTTTGTCTGATATGTTGGTGAGTACTGCTTGCAAACCCGATGTGTG
GACTATGAATATCATCCTTAGTGTGTTTGGAAACATGGGTAAGATAGACATGATGGAGAGCTGGTACGAAAAGTTCAGGA
ACTTTGGGATTGAGCCAGAGACTCGGACTTTCAATATTTTGATTGGTTCTTATGGGAAGAAGAGAATGTATGATAAGATG
TCGTCTGTCATGGAATACATGCGAAAGCTAGAGTTTCCGTGGACAACATCAACCTACAACAATATCATCGAGGCGTTTGC
GGATGTTGGTGATGCAAAGAACATGGAGTTGACATTTGATCAGATGCGTAGCGAAGGTATGAAAGCAGACACAAAGACCT
TTTGCTGTCTCATAAACGGATATGCCAATGCCGGTCTTTTCCACAAGGTGATAAGTAGTGTTCAGTTGGCTGCTAAGTTT
GAGATACCCGAGAATACTGCCTTTTACAACGCGGTGATATCAGCGTGTGCTAAAGCAGATGATCTGATAGAGATGGAAAG
AGTGTACATAAGAATGAAGGAGAGACAATGCGTATGCGATTCAAGAACGTTTGAGATCATGGTCGAGGCGTATGAAAAAG
AAGGTATGAATGATAAGATCTATTACTTGGAACAAGAGAGGCAAAAGCTTATGGATCGCACTGTTGCTACAAAAGAGATG
GAGAATCTTCCGGCAGGATGA