Details for Arabidopsis Locus AT3G06400

Position : Chr3 ( 5`- 1940973 .. 1946924 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06400

Protein [Map View]
MARNSNSDEAFSSEEEEERVKDNEEEDEEELEAVARSSGSDDDEVAAADESPVSDGEAAPVEDDYEDEEDEEKAEISKRE
KARLKEMQKLKKQKIQEMLESQNASIDADMNNKGKGRLKYLLQQTELFAHFAKSDGSSSQKKAKGRGRHASKITEEEEDE
EYLKEEEDGLTGSGNTRLLTQPSCIQGKMRDYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLAYLHEYRGINGP
HMVVAPKSTLGNWMNEIRRFCPVLRAVKFLGNPEERRHIREDLLVAGKFDICVTSFEMAIKEKTALRRFSWRYIIIDEAH
RIKNENSLLSKTMRLFSTNYRLLITGTPLQNNLHELWALLNFLLPEIFSSAETFDEWFQISGENDQQEVVQQLHKVLRPF
LLRRLKSDVEKGLPPKKETILKVGMSQMQKQYYKALLQKDLEAVNAGGERKRLLNIAMQLRKCCNHPYLFQGAEPGPPYT
TGDHLITNAGKMVLLDKLLPKLKERDSRVLIFSQMTRLLDILEDYLMYRGYLYCRIDGNTGGDERDASIEAYNKPGSEKF
VFLLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQKKEVQVFRFCTESAIEEKVIERAYKKLALDALVIQ
QGRLAEQKTVNKDELLQMVRYGAEMVFSSKDSTITDEDIDRIIAKGEEATAELDAKMKKFTEDAIQFKMDDSKGADFYDF
DDDNKDENKLDFKKIVSDNWNDPPKRERKRNYSESEYFKQTLRQGAPAKPKEPRIPRMPQLHDFQFFNIQRLTELYEKEV
RYLMQTHQKNQLKDTIDVEEPEGGDPLTTEEVEEKEGLLEEGFSTWSRRDFNTFLRACEKYGRNDIKSIASEMEGKTEEE
VERYAKVFKERYKELNDYDRIIKNIERGEARISRKDEIMKAIGKKLDRYRNPWLELKIQYGQNKGKLYNEECDRFMICMI
HKLGYGNWDELKAAFRTSSVFRFDWFVKSRTSQELARRCDTLIRLIEKENQEFDERERQARKEKKLAKSATPSKRPLGRQ
ASESPSSTKKRKHLSMR*

DNA
ATGGCGAGAAATTCGAATTCCGATGAGGCTTTCTCGTCAGAGGAGGAAGAAGAGCGGGTTAAGGATAATGAAGAAGAAGA
TGAGGAGGAGCTCGAGGCTGTTGCTCGTTCTTCTGGCTCCGACGATGACGAAGTAGCCGCCGCCGACGAATCACCAGTCT
CCGACGGAGAGGCTGCTCCCGTAGAAGATGATTACGAGGACGAAGAAGATGAGGAAAAAGCTGAAATCAGCAAACGTGAG
AAAGCCAGACTTAAAGAGATGCAGAAGTTGAAGAAGCAGAAGATTCAAGAGATGCTGGAGTCGCAGAATGCTTCCATTGA
CGCGGATATGAACAATAAGGGAAAAGGGAGACTGAAGTATCTTCTGCAGCAAACTGAGTTATTTGCCCACTTTGCTAAAA
GTGATGGATCTTCTTCTCAGAAGAAGGCAAAAGGAAGGGGACGTCATGCTTCCAAAATAACTGAAGAGGAGGAAGACGAA
GAGTATCTAAAGGAAGAAGAGGATGGCTTAACTGGATCTGGAAACACACGGTTACTCACACAGCCCTCTTGTATTCAAGG
GAAGATGAGAGATTACCAATTAGCTGGTTTGAACTGGCTCATTCGTCTTTATGAGAATGGCATAAATGGAATTCTTGCTG
ATGAAATGGGTCTGGGGAAGACGCTTCAAACGATTTCTTTGTTGGCATATCTTCATGAATACAGGGGAATCAATGGTCCC
CATATGGTGGTTGCTCCAAAATCAACACTTGGTAATTGGATGAACGAAATTCGCCGGTTTTGTCCTGTCCTACGTGCTGT
GAAGTTCCTTGGTAATCCTGAGGAGAGGAGACATATTCGAGAAGACCTGCTAGTTGCTGGGAAATTTGATATTTGTGTCA
CAAGCTTTGAGATGGCCATCAAAGAGAAGACAGCACTTCGTCGGTTTAGCTGGCGTTATATTATCATTGATGAAGCGCAT
CGAATCAAGAACGAGAATTCACTCCTTTCTAAAACCATGAGACTTTTTAGCACCAATTATCGGCTTCTTATCACGGGGAC
CCCCCTTCAGAATAATCTCCATGAACTGTGGGCTCTTCTAAATTTTCTTCTGCCTGAGATTTTTAGTTCAGCAGAGACTT
TTGATGAATGGTTTCAAATTTCTGGTGAGAATGACCAGCAAGAAGTTGTGCAACAACTGCACAAGGTTCTTCGACCATTT
CTTCTTCGAAGACTAAAGTCAGATGTTGAGAAAGGTTTGCCACCGAAGAAGGAGACCATACTTAAAGTTGGTATGTCTCA
GATGCAAAAGCAATACTACAAGGCTTTACTGCAGAAGGATCTTGAAGCGGTTAATGCTGGTGGAGAACGCAAACGTCTGC
TAAACATTGCAATGCAACTGCGTAAATGCTGCAATCACCCCTATCTCTTCCAGGGTGCAGAACCTGGTCCCCCATATACC
ACAGGAGATCACCTTATAACAAATGCTGGTAAGATGGTTCTCTTGGATAAATTGCTTCCTAAGTTGAAAGAACGTGATTC
AAGGGTGCTGATATTTTCTCAGATGACAAGACTTTTGGATATTCTTGAGGACTATTTAATGTATCGTGGTTACTTGTATT
GCCGTATTGATGGAAACACTGGTGGTGACGAACGAGATGCCTCCATAGAAGCCTACAACAAGCCAGGAAGTGAGAAATTT
GTTTTCTTGTTATCTACTAGAGCTGGAGGGCTTGGTATCAATCTTGCTACTGCAGATGTTGTGATCCTTTACGATAGTGA
TTGGAACCCACAAGTCGACTTGCAAGCTCAGGATCGTGCCCATAGGATTGGTCAAAAAAAAGAAGTTCAAGTGTTTCGAT
TCTGCACTGAGTCTGCTATTGAGGAGAAAGTGATTGAAAGAGCTTACAAGAAGTTAGCACTTGATGCTCTGGTTATTCAA
CAAGGGAGATTGGCAGAACAGAAAACTGTCAATAAGGATGAGTTGCTTCAAATGGTAAGATATGGTGCTGAGATGGTGTT
CAGTTCTAAAGATAGCACAATCACAGACGAGGATATTGATAGAATCATTGCCAAAGGAGAAGAGGCAACAGCTGAACTTG
ATGCTAAGATGAAGAAATTCACAGAAGATGCTATACAGTTTAAAATGGATGACAGTAAGGGTGCTGACTTCTATGATTTT
GATGATGACAATAAGGATGAAAACAAGCTCGATTTTAAAAAGATTGTAAGCGACAATTGGAATGATCCCCCCAAGCGGGA
GAGAAAGCGCAACTACTCTGAATCTGAGTACTTTAAGCAAACATTGCGGCAAGGTGCTCCAGCTAAACCTAAAGAGCCTA
GAATTCCGCGCATGCCCCAGTTGCACGATTTCCAGTTCTTTAACATTCAGAGATTGACCGAGTTGTATGAAAAGGAAGTA
CGTTATCTCATGCAAACACATCAGAAAAATCAGTTGAAAGACACAATTGATGTTGAAGAACCAGAAGGTGGGGATCCCTT
AACTACTGAAGAAGTAGAAGAAAAGGAGGGATTATTGGAGGAGGGTTTCTCAACATGGAGCAGAAGAGATTTTAATACTT
TCCTCAGGGCTTGTGAGAAGTATGGCCGCAACGACATAAAAAGCATTGCCTCTGAGATGGAAGGGAAAACAGAGGAAGAA
GTTGAAAGATATGCCAAAGTATTTAAAGAGCGGTACAAGGAGCTGAACGACTATGATAGAATCATTAAGAACATTGAGAG
GGGAGAGGCAAGGATCTCTAGGAAAGACGAAATCATGAAGGCCATAGGGAAGAAACTGGATCGCTACAGAAACCCTTGGC
TGGAACTGAAGATTCAATATGGTCAGAACAAAGGCAAGCTGTACAATGAAGAGTGTGACCGTTTCATGATCTGCATGATT
CACAAACTTGGTTATGGGAATTGGGATGAGCTAAAGGCAGCATTTAGGACATCGTCTGTGTTCAGGTTTGACTGGTTTGT
GAAATCCCGCACGAGTCAGGAACTTGCAAGAAGATGCGACACTCTGATTCGACTGATCGAGAAAGAGAACCAGGAGTTTG
ATGAAAGAGAGAGGCAAGCCCGCAAAGAGAAGAAGCTCGCGAAGAGTGCAACACCATCAAAGCGACCTTTAGGAAGACAA
GCAAGTGAGAGTCCTTCATCGACGAAGAAGCGGAAGCACCTGTCGATGAGATGA