Details for Arabidopsis Locus AT3G06370

Position : Chr3 ( 5`- 1930396 .. 1934073 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06370

Protein [Map View]
MVIGLSTMLEKTEALFASDHASVVSMNLFVALLCACIVLGHLLEETRWMNESITALIIGSCTGIVILLISGGKSSRILVF
SEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIGTLISFVIISFGAKHLFEKMNIGDLTIADYLAIGAIFSATD
SVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIQRFDLTNINSAIALEFAGNFFYLFILSTALGVAAGLLSAFVI
KKLYIGRHSTDREVALMMLLAYLSYMLAELFHLSSILTVFFCGIVMSHYTWHNVTDKSKVTTKHTFAAMSFLAEIFIFLY
VGMDALDIEKWDVVRNSPGQSIGVSSILLGLILLGRAAFVFPLSFLSNLTKSSPDEKIDLKKQVTIWWAGLMRGAVSMAL
AYNQFTTSGHTKVLGNAIMITSTITVVLFSTVVFGLLTKPLVKHLQPSSKQSSTTALQITLRSSFHDPILHEPLLSTQGQ
SEYDPEQHVSFRMFWKSPSRFTH*

DNA
ATGGTGATCGGATTAAGCACAATGCTGGAAAAAACAGAGGCTCTTTTCGCTTCTGATCATGCATCGGTCGTCTCCATGAA
TTTGTTCGTAGCTTTGCTTTGTGCTTGCATCGTGCTTGGTCACTTGCTTGAGGAGACTCGGTGGATGAACGAGTCAATCA
CTGCTCTTATCATTGGTTCGTGTACTGGGATTGTGATCTTGCTTATAAGTGGAGGCAAAAGCTCAAGGATTCTTGTGTTT
AGTGAAGATCTCTTCTTTATTTATCTTCTTCCACCAATTATATTCAACGCAGGGTTTCAGGTTAAGAAGAAGCAATTTTT
TCGCAACTTCATGACCATTATGTTATTTGGTGCTATTGGAACTCTCATTTCATTTGTTATCATCTCATTTGGTGCTAAAC
ATCTTTTCGAGAAAATGAATATCGGTGATCTTACCATTGCGGACTATCTAGCCATTGGAGCAATATTCTCTGCTACAGAC
TCTGTTTGCACCTTGCAAGTGCTTAATCAAGACGAGACACCTCTCTTGTACAGTCTTGTCTTTGGAGAAGGTGTAGTGAA
CGATGCCACATCGGTCGTGCTCTTCAATGCAATACAGAGATTCGACCTCACAAATATCAATTCAGCCATAGCTTTGGAGT
TTGCTGGAAACTTTTTTTACCTCTTTATCTTAAGCACAGCACTTGGTGTTGCAGCTGGATTGCTCAGTGCTTTTGTTATC
AAGAAGCTCTATATAGGAAGGCACTCTACTGATCGTGAAGTTGCACTTATGATGCTATTGGCTTACTTATCATATATGTT
GGCAGAGCTATTCCACTTGAGCTCTATCTTGACTGTGTTCTTCTGCGGGATTGTTATGTCTCACTATACATGGCACAATG
TTACAGATAAATCCAAGGTCACTACAAAACATACTTTTGCTGCAATGTCATTTCTAGCTGAGATTTTTATCTTCCTTTAC
GTTGGAATGGACGCTCTCGATATCGAGAAATGGGACGTTGTACGCAACAGTCCTGGTCAGTCGATTGGAGTTAGTTCAAT
ACTTCTTGGGCTTATTCTTCTGGGTCGCGCCGCGTTCGTGTTTCCACTTTCCTTCTTGTCCAATTTAACAAAGTCTTCAC
CGGATGAGAAAATAGACTTAAAGAAACAAGTAACCATTTGGTGGGCTGGTCTGATGCGTGGTGCAGTGTCAATGGCTCTT
GCTTATAACCAGTTCACAACTTCAGGACACACCAAGGTTCTTGGGAACGCTATCATGATCACCAGTACCATCACTGTTGT
TCTTTTCAGTACTGTGGTGTTTGGATTGCTAACCAAACCGTTAGTCAAACATTTGCAGCCTTCATCAAAACAGTCCTCCA
CGACCGCGCTGCAGATCACACTAAGATCTTCTTTCCACGATCCGATCCTCCATGAGCCGTTGCTCAGTACCCAAGGCCAG
TCAGAATACGACCCTGAACAACATGTTAGCTTCAGAATGTTCTGGAAATCTCCTTCCAGGTTCACCCATTGA