Details for Arabidopsis Locus AT3G06360

Position : Chr3 ( 5`- 1928902 .. 1929446 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06360

Protein [Map View]
MASSILLTLITFIFLSSLSLSSPTTNTIPSSQTISPSEEKISPEIAPLLPSPAVSSTQTIPSSSTLPEPENDDVSADPDP
AFAPSASPPASSLASLSSQAPGVFIYFVFAAVYCFSLRLLAVSAI*

DNA
ATGGCTTCATCTATATTGCTAACACTCATCACCTTCATCTTTCTCTCCTCACTTTCTCTCTCTTCGCCGACGACAAATAC
AATCCCATCTTCGCAAACAATCTCTCCCTCTGAAGAAAAGATCTCACCGGAGATCGCTCCTCTCCTCCCTTCACCCGCCG
TCTCCTCCACTCAAACCATCCCTTCTTCTTCAACACTTCCTGAACCAGAAAACGACGACGTTTCCGCAGATCCTGATCCC
GCCTTCGCTCCATCGGCTTCTCCTCCGGCTTCATCTCTTGCTTCTCTGTCTTCTCAAGCTCCCGGAGTTTTCATCTACTT
TGTCTTCGCCGCCGTCTATTGTTTCTCGCTCCGGCTTCTTGCCGTTTCAGCTATATAG