Details for Arabidopsis Locus AT3G06320

Position : Chr3 ( 5`- 1914511 .. 1915318 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06320

Protein [Map View]
MGDKRKKTFMFIRLVSAAGTGFFYVKRKSTKGLLEKLEFRKYDPRVNRHVLFTEQKMK*

DNA
ATGGGAGACAAGAGGAAGAAGACGTTCATGTTCATCCGTCTAGTTTCAGCAGCTGGAACTGGATTCTTCTATGTCAAGAG
GAAGAGTACCAAGGGACTTCTTGAGAAGCTCGAGTTCCGTAAGTACGATCCTCGAGTTAATCGCCATGTCCTCTTTACAG
AGCAGAAAATGAAGTGA