Details for Arabidopsis Locus AT3G06290

Position : Chr3 ( 5`- 1899042 .. 1907297 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06290

Protein [Map View]
MAFRPFGKDLGPMSSKPAPFTPFGASSTTRLYLSFLFLHTANVGFACSDSSIQPPASQNHSAFAGQSFGPGGIRSGPSIQ
RAPPLSASQNPQLSIGKPYRPGGVQSVPPINRIPSPSAFQNPSPSSGQPYQPGGIQRIPEPFNGIAWGPEASRTSPSVRP
YQFPGVQRPNLNPQYGHDGSRNFLKDHGEHSRATSPPATSHILSRMGTDAVEIGRSQDSKRKSRSDILPDQNMGFSRRNQ
SPVSGFENGNLVDGFQPLSSRTWMRSPSSAENNPVRSRSNPNQLIHQEQTGNSSFPYAHEVAEIQEATRRKSSAVAPSDK
PLGDDPILSQHDSQRFSTSPPTSGTKSYTLSRSSDSQFPGQPSSVNSFNNARKTNSSPATKRTRSPPVYPIEEDIPRNSF
PSQDCTEGEEQARAKRLARFKGELEPIADRPVDIQLTKSPVNKTMKPLDNKQTFNSLESSRDALKGDALPDYENSEQPSL
IIGVCPDMCPESERGERERKGDLDHYERVDGDRNQTSKSLAVKKYTRTAEREAILIRPMPILQNTMEYLLSLLDRPYNEN
FLGMYNFLWDRMRAIRMDLRMQHIFNQEAITLLEQMIRLHIIAMHELCEYTKGEGFSEGFDAHLNIEQMNKTSVELFQMY
DDHRKKGITVPTEKEFRGYYALLKLDKHPGYKVEPSELSLDLANMTPEIRQTSEVLFARNVARACRTGNFIAFFRLARKA
SYLQACLMHAHFSKLRTQALASLHSGLQINQGLPVSDMSNWIGMEEEDIEALLEYHGFSIKVFEEPYMVKNDLFLHADKD
YKTKCSKLVHMKKSRTIVEDVSAPTVVEDVSTPFPLPSLITEATIGNQQCITAHKHEMPPARSLKKQTSMRLFDKEVADS
KTSLLAEEDKPMGTFVMNPPGPFVINPVVHQEKQNDLTSAGGFHSPVKLYSPFGSPKFPQTKSSNLEKQPNDDRIGMSPG
EIKFSIIGDVYTNHVPGPALQQSPKSMPMEIMPVTTIAECPTSVENKYALEESVPEAAMICTLEKEFNDIDEEDEDEDGV
ILNQYDEEVAKAKLKLIIRLWKRWSSRQSELRERRQLAAAAALNSLSLGTPIRFSKTDQSRACGEFNIDQAMRRRFEERE
KSWSRLNISDVIADILVGRNPESKCISWKVVLCTQTKSVNSSSSASQVTHSAASRWLSSKLMPHAEHSSLNDDNLLFSAP
GVSVWNKWVANGSDIDFTCCLSVARDVEAENDMCETTCGASAVLFLASGGLPLNLQREQLNLILESVPNGSVLPLLVVIS
SCNGEHMEPDTDIVSGLGLHDIDKSKIASFSIVSIANKSQKGQEVHFFNDSRLRDGFKWLASNSPLQPNLHHVKLRELFL
THFSFSLELLKQMPDQEVGPNICISAFNDALETSRRNITSAAEANPIGWPCPETMLLEDNRKECLMVKRYLPNLDWSSAE
NVELLSSVLENCKLPDFEDDLTWLTVGCASGAEIENHTQRLEGCLIEYLTQRSNLMGVSLATKETGVMLERNTRLELHNS
SRYHITPRWIGIFQRIFNWRIMGLFDASSSSAYVLKSDLNMSTSSYADKFLAEDASYPSCPPNLPLLHEMIEISCSPLKS
PPPYDDKAQRVVETGMLIDDHRDIEESMLEKNREACRGIDLMITEDDELGERSWRSKGREAAEKKTIEKRESERLDELLE
KCNMVQNSIAEKLCIYF*

DNA
ATGGCGTTTAGGCCTTTCGGGAAGGACTTAGGTCCGATGAGCTCTAAGCCAGCGCCGTTTACACCGTTCGGTGCTTCTTC
AACCACTAGATTGTACCTTTCTTTTTTATTCTTACACACTGCGAATGTTGGATTTGCTTGTAGTGATTCATCAATTCAAC
CACCGGCGTCTCAAAACCATTCAGCCTTTGCAGGACAATCTTTTGGACCTGGTGGAATTCGAAGTGGTCCTTCAATTCAG
CGAGCACCACCTCTGTCGGCTTCTCAAAACCCTCAGCTCTCTATAGGGAAACCTTACCGACCAGGTGGGGTTCAAAGTGT
TCCTCCAATTAATAGAATACCATCTCCGTCGGCTTTTCAAAATCCATCACCCTCCTCAGGACAACCTTACCAACCTGGTG
GAATTCAAAGGATCCCAGAACCTTTCAATGGAATAGCATGGGGTCCAGAAGCTTCACGTACAAGCCCCTCTGTGAGACCT
TACCAATTTCCTGGAGTTCAGAGGCCTAATTTAAATCCTCAATATGGGCACGATGGATCAAGGAATTTCTTGAAAGATCA
TGGTGAACATAGTCGAGCCACGTCTCCACCTGCTACATCTCACATTCTTTCCAGAATGGGAACTGATGCTGTTGAGATTG
GTCGATCACAAGATTCAAAAAGAAAAAGTCGGTCAGATATTCTTCCTGACCAGAATATGGGGTTTTCTCGAAGAAATCAA
TCGCCAGTATCAGGTTTTGAGAATGGAAACTTGGTAGATGGTTTTCAGCCACTTTCTAGCCGAACTTGGATGCGCTCTCC
GTCTTCTGCGGAGAATAATCCGGTGAGGTCGAGGAGCAATCCCAATCAGTTGATTCATCAAGAACAAACCGGAAACTCGT
CATTCCCCTATGCACATGAAGTAGCTGAAATTCAGGAAGCTACTAGAAGAAAGTCTTCGGCTGTAGCACCTTCTGATAAA
CCCCTTGGAGATGACCCCATATTGTCTCAACATGACTCTCAAAGGTTTTCGACATCTCCACCTACGTCAGGCACAAAGTC
ATATACACTTTCAAGAAGTTCAGATTCTCAATTTCCTGGACAGCCCTCCTCTGTAAATAGTTTCAATAATGCGCGTAAGA
CAAACAGTTCACCTGCAACAAAAAGGACGAGATCTCCACCTGTATATCCAATTGAAGAGGATATCCCGCGAAACTCTTTC
CCTTCTCAAGATTGTACAGAAGGAGAAGAGCAAGCCAGGGCAAAGAGACTGGCCCGCTTCAAGGGTGAACTGGAGCCTAT
TGCAGACCGACCTGTTGATATTCAACTTACTAAATCACCTGTAAATAAAACTATGAAGCCTCTGGACAACAAACAAACAT
TCAATTCGCTTGAATCAAGTAGGGATGCCCTGAAGGGAGATGCCTTGCCTGATTATGAAAACTCGGAGCAGCCCTCTCTT
ATCATTGGAGTATGCCCTGACATGTGTCCTGAGTCAGAACGGGGGGAGCGTGAGAGGAAGGGTGACTTGGACCATTATGA
GCGTGTGGATGGAGATAGGAACCAGACAAGCAAATCCCTTGCTGTGAAGAAATATACTAGGACGGCGGAGCGAGAAGCAA
TTTTGATACGACCAATGCCAATCCTGCAAAATACAATGGAATATTTGCTGAGTTTGCTAGACCGACCTTACAATGAAAAC
TTTCTTGGCATGTACAATTTCTTATGGGATAGGATGAGAGCTATACGTATGGATCTAAGAATGCAACATATTTTCAACCA
AGAAGCTATTACTTTGCTGGAGCAAATGATTAGACTTCACATCATTGCAATGCATGAGCTATGTGAATATACTAAAGGAG
AGGGCTTTTCGGAGGGGTTTGATGCACACCTGAATATTGAGCAGATGAACAAGACATCTGTTGAGTTGTTTCAAATGTAT
GATGATCACAGGAAGAAAGGAATAACTGTTCCTACAGAAAAAGAGTTTCGTGGCTATTATGCCCTTCTCAAACTCGACAA
GCATCCTGGCTATAAGGTTGAACCTTCAGAACTTTCTCTTGATCTTGCCAATATGACTCCAGAAATAAGGCAAACTTCAG
AAGTTCTCTTTGCCCGCAATGTAGCCAGAGCTTGCAGAACTGGCAACTTCATCGCCTTCTTTCGCCTTGCACGGAAAGCA
AGCTATCTTCAAGCATGTCTAATGCATGCTCATTTTTCGAAACTAAGAACTCAGGCGCTTGCCTCTCTGCACTCGGGTCT
CCAAATTAATCAGGGTCTCCCAGTTTCAGATATGTCAAATTGGATAGGGATGGAGGAAGAGGACATAGAAGCCCTGTTGG
AGTACCATGGGTTTTCGATAAAGGTTTTTGAAGAGCCATACATGGTAAAAAATGACCTATTTCTCCATGCTGATAAGGAT
TACAAAACAAAATGCTCAAAACTTGTTCACATGAAAAAGTCAAGAACCATAGTGGAAGATGTTTCTGCTCCCACAGTAGT
GGAAGATGTTTCTACTCCCTTTCCATTGCCTTCCTTGATCACAGAAGCAACTATCGGAAATCAACAGTGTATTACCGCCC
ATAAACACGAAATGCCGCCTGCGAGAAGTCTTAAGAAACAAACATCAATGCGTCTATTTGATAAAGAAGTGGCTGACTCC
AAGACTTCCCTCTTAGCAGAGGAGGACAAGCCAATGGGGACATTTGTTATGAATCCACCAGGGCCATTCGTTATAAATCC
AGTGGTGCATCAAGAGAAACAAAATGACCTTACATCAGCTGGTGGATTTCATTCTCCCGTGAAGCTATATTCTCCTTTTG
GTTCCCCTAAATTTCCTCAAACTAAATCGTCGAATTTGGAGAAACAACCTAATGACGATCGCATCGGTATGTCTCCTGGG
GAAATTAAATTTTCAATCATAGGGGATGTATATACGAATCATGTGCCTGGACCAGCTTTGCAACAAAGTCCGAAGTCTAT
GCCAATGGAGATTATGCCTGTAACTACCATTGCAGAGTGTCCGACAAGTGTAGAAAACAAATATGCTTTGGAAGAATCAG
TACCGGAGGCTGCAATGATTTGTACCTTGGAAAAGGAGTTCAATGACATTGACGAGGAAGACGAGGATGAGGATGGGGTC
ATCTTAAATCAGTATGATGAGGAAGTGGCGAAAGCAAAACTCAAGTTGATCATAAGATTATGGAAGCGGTGGTCTTCACG
TCAAAGTGAATTGCGGGAGCGTCGACAGTTAGCAGCAGCTGCTGCACTGAATTCACTATCCCTGGGTACTCCTATCCGAT
TTAGCAAAACTGATCAATCGAGGGCGTGTGGTGAGTTTAACATTGATCAAGCCATGAGGAGGAGATTTGAAGAACGTGAG
AAATCATGGTCAAGGCTGAATATTTCTGATGTGATAGCTGATATACTAGTTGGAAGGAATCCAGAATCAAAATGCATAAG
CTGGAAGGTCGTCTTATGTACTCAGACTAAATCAGTAAACTCATCATCTTCTGCAAGTCAGGTTACGCATTCAGCAGCCA
GTCGATGGTTATCATCAAAGCTTATGCCTCATGCAGAACATAGTAGTCTCAACGATGATAATCTGCTGTTTTCAGCTCCC
GGCGTGTCTGTATGGAACAAATGGGTTGCAAATGGGTCTGATATAGATTTCACATGCTGTCTCTCAGTAGCTAGGGATGT
GGAGGCTGAGAATGATATGTGTGAAACAACATGTGGTGCAAGTGCAGTCCTTTTCCTTGCATCTGGAGGCCTCCCTTTGA
ATCTTCAGAGAGAACAGCTTAACCTCATTCTTGAATCAGTACCCAACGGTTCAGTTCTTCCCCTTCTCGTAGTAATTAGC
TCATGCAATGGGGAACACATGGAGCCTGATACCGACATTGTCTCGGGATTAGGCCTCCATGATATTGACAAGTCAAAGAT
AGCAAGCTTTTCCATCGTTTCTATTGCTAATAAGTCCCAAAAGGGGCAGGAAGTTCATTTTTTCAATGATTCACGGCTAA
GAGATGGGTTTAAATGGCTAGCAAGCAATTCACCTCTGCAACCAAATCTTCATCATGTTAAACTCCGGGAACTGTTTCTG
ACCCATTTCAGTTTTTCCTTGGAGTTGCTTAAGCAGATGCCAGATCAGGAGGTTGGTCCTAACATCTGCATATCAGCCTT
CAACGACGCATTGGAAACATCACGAAGAAACATCACTTCTGCTGCTGAAGCAAATCCCATCGGTTGGCCTTGCCCTGAGA
CAATGTTGCTCGAGGATAATAGAAAAGAATGTTTAATGGTCAAGCGGTATCTTCCCAACCTGGACTGGAGCAGTGCAGAG
AACGTCGAACTACTCAGTTCCGTGCTAGAGAATTGTAAGCTCCCAGATTTTGAAGATGATTTGACATGGCTAACCGTAGG
ATGTGCTTCTGGTGCTGAGATAGAGAACCACACGCAAAGGCTTGAGGGATGCTTAATTGAGTACTTAACACAGAGAAGCA
ATCTTATGGGAGTCTCATTAGCTACTAAAGAAACAGGAGTGATGCTAGAAAGAAACACTAGACTCGAACTCCATAACTCA
AGCCGCTACCATATCACCCCGAGATGGATTGGTATCTTCCAGAGGATCTTCAACTGGCGGATAATGGGTTTGTTTGATGC
ATCATCTTCCTCAGCTTACGTACTGAAGTCTGATCTCAACATGTCAACTTCAAGCTATGCAGATAAATTCTTGGCTGAAG
ATGCATCATACCCATCTTGTCCTCCAAATCTTCCATTGCTTCATGAAATGATAGAAATCAGCTGCAGCCCCTTGAAGTCG
CCTCCTCCATATGATGACAAAGCCCAGAGAGTTGTTGAGACAGGAATGCTCATCGATGATCATAGAGATATAGAGGAATC
GATGTTGGAAAAGAACAGAGAAGCTTGTCGAGGTATTGATCTGATGATAACTGAGGATGATGAGTTAGGCGAGAGATCAT
GGAGAAGTAAAGGTAGAGAAGCGGCAGAGAAGAAGACGATAGAGAAGAGAGAGAGTGAGAGATTAGATGAATTGTTGGAA
AAATGTAACATGGTACAGAATAGCATAGCCGAGAAGCTCTGTATTTACTTCTGA