Details for Arabidopsis Locus AT3G06240

Position : Chr3 ( 5`- 1887043 .. 1888750 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06240

Protein [Map View]
MKAIQLLWEAIMEATKRERRREDDDGEKASPESLVLPPEIITEILLRLPAKSIGRFRCVSKLFCTLSSDPGFAKIHLDLI
LRNESVRSLHRKLIVSSHNLYSLDFNSIGDGIRDLAAVEHNYPLKDDPSIFSEMIRNYVGDHLYDDRRVMLKLNAKSYRR
NWVEIVGSSNGLVCISPGEGAVFLYNPTTGDSKRLPENFRPKSVEYERDNFQTYGFGFDGLTDDYKLVKLVATSEDILDA
SVYSLKADSWRRICNLNYEHNDGSYTSGVHFNGAIHWVFTESRHNQRVVVAFDIQTEEFREMPVPDEAEDCSHRFSNFVV
GSLNGRLCVVNSCYDVHDDIWVMSEYGEAKSWSRIRINLLYRSMKPLCSTKNDEEVLLELDGDLVLYNFETNASSNLGIC
GVKLSDGFEANTYVESLISPNSYGIES*

DNA
ATGAAAGCGATCCAGTTGCTGTGGGAAGCGATAATGGAGGCGACGAAGAGAGAAAGACGGAGAGAAGATGACGACGGCGA
AAAAGCTTCACCGGAATCACTCGTTCTTCCACCAGAGATCATTACAGAAATTCTTCTCCGATTACCAGCCAAATCGATCG
GGCGATTCAGGTGCGTATCAAAGCTCTTTTGCACTTTATCGTCAGATCCAGGGTTCGCGAAGATTCACCTCGATCTGATC
CTTCGAAACGAATCCGTAAGATCGCTCCACCGTAAGCTCATTGTGTCTTCACATAATCTGTACTCGTTAGATTTCAATTC
GATCGGTGACGGAATTAGGGATTTAGCGGCTGTGGAACACAATTATCCTCTTAAAGACGATCCAAGCATTTTCTCTGAGA
TGATTAGGAATTACGTGGGGGACCATCTGTACGATGATCGTCGCGTGATGCTTAAGCTGAATGCGAAATCGTATCGAAGA
AACTGGGTTGAGATCGTTGGATCTTCCAATGGTTTAGTGTGTATCTCTCCTGGTGAAGGAGCTGTTTTCTTGTATAATCC
AACTACCGGAGATTCCAAGAGATTACCTGAAAATTTTCGTCCCAAATCTGTAGAATACGAAAGAGATAATTTCCAAACTT
ATGGATTTGGTTTCGATGGTCTCACTGATGATTACAAATTGGTGAAGCTTGTTGCTACCAGTGAAGATATTCTCGATGCT
AGTGTCTATTCCTTGAAGGCTGACTCATGGAGACGGATCTGCAATTTGAATTATGAGCACAACGATGGCTCCTACACGTC
CGGTGTGCATTTCAACGGTGCGATTCACTGGGTGTTCACAGAGAGTAGGCACAACCAAAGAGTGGTTGTAGCATTTGATA
TTCAAACCGAGGAGTTTCGAGAGATGCCAGTGCCTGATGAAGCTGAAGATTGTTCCCATAGGTTTAGCAACTTTGTGGTC
GGAAGTCTCAATGGACGTCTCTGTGTGGTCAATAGTTGCTACGATGTGCATGATGATATATGGGTGATGAGTGAGTACGG
TGAAGCTAAATCCTGGAGCAGAATTCGAATCAACTTGTTGTATAGGTCGATGAAACCGCTCTGTTCGACTAAGAACGATG
AAGAGGTTCTTCTGGAGCTTGATGGAGACCTGGTGTTGTACAACTTTGAAACCAATGCATCGAGTAATCTAGGAATTTGT
GGGGTTAAGCTCAGTGACGGGTTCGAGGCAAATACATACGTAGAGAGCCTCATATCACCCAACTCTTATGGTATAGAGAG
CTGA