Details for Arabidopsis Locus AT3G06230

Position : Chr3 ( 5`- 1885496 .. 1886377 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06230

Protein [Map View]
MVMVRDNQFLNLKLSPIQAPTTIPPCRFPIIPATKVSATVSSCASNTFSVANLDRISVLGSGNGGTVFKVKDKTTSEIYA
LKKVKENWDSTSLREIEILRMVNSPYVAKCHDIFQNPSGEVSILMDYMDLGSLESLRGVTEKQLALMSRQVLEGKNYLHE
HKIVHRDIKPANLLRSSKEEVKIADFGVSKIVVRSLNKCNSFVGTFAYMSPERLDSEADGVTEEDKSNVYAGDIWSFGLT
MLEILVGYYPMLPDQAAIVCAVCFGEPPKAPEECSDDLKSFMDCCLRKKASER*

DNA
ATGGTTATGGTTAGAGATAATCAATTCCTTAACCTCAAACTGTCTCCTATACAAGCTCCTACTACTATCCCCCCTTGCCG
CTTCCCCATCATACCCGCTACAAAAGTCTCTGCAACAGTTTCTTCCTGCGCAAGCAACACTTTTTCTGTAGCTAATTTGG
ACAGAATCAGTGTTCTTGGCAGTGGAAACGGAGGAACCGTATTCAAAGTTAAGGACAAGACAACCTCAGAGATCTACGCG
TTGAAGAAAGTGAAAGAAAACTGGGATTCTACTTCCCTCCGTGAGATCGAAATCCTTCGCATGGTCAACTCTCCTTACGT
CGCAAAGTGTCACGACATCTTCCAGAATCCTTCCGGAGAAGTATCTATTCTAATGGATTACATGGATCTTGGCTCGCTCG
AGTCTCTACGCGGGGTTACAGAAAAACAACTCGCTTTGATGTCTCGTCAAGTTTTGGAAGGAAAAAATTACTTGCACGAG
CACAAGATCGTTCATAGAGACATCAAGCCAGCGAATCTGCTACGTAGCTCAAAAGAAGAAGTCAAGATCGCAGACTTTGG
AGTGAGCAAGATCGTGGTCAGGTCTTTAAACAAGTGCAACTCGTTCGTAGGCACGTTCGCATACATGAGTCCTGAAAGAC
TCGATAGTGAAGCTGATGGTGTTACAGAAGAAGACAAATCAAACGTTTACGCCGGAGATATATGGAGTTTTGGGCTTACG
ATGCTCGAGATCTTGGTGGGTTACTACCCGATGCTACCAGACCAAGCCGCGATAGTATGTGCAGTTTGTTTTGGAGAACC
ACCAAAAGCCCCCGAAGAATGCTCTGACGATTTGAAGAGTTTCATGGACTGCTGTTTACGCAAGAAAGCAAGCGAGAGAT
AG