Details for Arabidopsis Locus AT3G06190

Position : Chr3 ( 5`- 1874291 .. 1876913 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06190

Protein [Map View]
MDTIRVSKEVPGSSKSTAQSLTESTSRTETINGSHEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDGKSPEDN
SVYVSLFIALASEGADVRALFELTLVDQSGNERHKVHSHFGRTLESGPYTLKYRGSMWGYKRFFKRSLLESSDYLKDNGL
LVRCCVGVVKSRTEGPRCYNIPVPVSGLGQQFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLRSENT
NCIIIEDVQAPIFKMLLHFIYWDEMPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEGISINTVATTL
ALAEQHHCFQLKAACLKFIALPENLKAVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGHRKELFADGCDLNGRR
VKQRLH*

DNA
ATGGACACAATTAGGGTTTCCAAGGAGGTTCCTGGATCTTCGAAATCGACCGCACAGTCGCTCACGGAGTCGACCTCTCG
CACGGAAACCATCAATGGCTCCCACGAATTCAAGATCAGCGGCTACTCTTTGGTCAAAGGCATGGGGATTGGCAAATACG
TTGCCTCGGATACTTTCATGGTCGGTGGATACTCCTGGGCCATCTACTTCTACCCAGATGGAAAGAGTCCAGAGGATAAT
TCTGTCTACGTGTCTCTCTTCATAGCCCTTGCGAGTGAAGGAGCCGATGTTAGGGCTTTGTTTGAGCTTACCCTCGTGGA
TCAGAGCGGTAACGAAAGGCACAAAGTTCATAGCCATTTTGGTAGAACTCTCGAAAGCGGACCCTATACTCTTAAATATC
GAGGGAGTATGTGGGGATACAAACGATTTTTCAAGAGGTCTCTTTTGGAGTCATCGGACTATCTGAAGGACAATGGTCTC
TTGGTCCGGTGTTGTGTTGGAGTGGTGAAGTCACGCACAGAAGGACCGAGGTGTTACAATATCCCGGTGCCGGTTTCTGG
CTTGGGTCAGCAGTTTGGAAAGCTTTTGGAAAGTGGGAAAGGAGCTGACGTTACTTTCGAAGTTGATGGAGAAACATTTC
CTGCTCACAAATTGGTTCTTGCAGCACGTTCTGCAGTTTTCAGGGCACAGCTTTTTGGCCCGTTGAGAAGTGAAAATACC
AATTGTATAATCATAGAAGACGTACAAGCCCCTATTTTCAAGATGTTGCTTCATTTTATCTACTGGGATGAAATGCCTGA
TATGCAAGACTTAATCGGCACAGACTTGAAATGGGCATCAACTCTTGTGGCTCAGCATCTGCTTGCAGCTGCAGACCGTT
ATGCTCTTGAGCGGCTTAGAACAATATGCGAGTCAAAACTCTGTGAAGGAATCAGCATAAATACGGTAGCAACCACCTTG
GCTCTTGCAGAGCAGCATCATTGTTTCCAGCTGAAAGCCGCCTGCCTCAAATTTATAGCTTTGCCAGAAAACCTGAAAGC
TGTGATGGAAACGGATGGGTTTGATTATCTGAAGGAAAGCTGCCCGTCCCTACTAAGTGAGCTATTGGAGTATGTGGCTA
GGCTGAGTGAGCACTCTTTAACATCATCAGGGCATCGAAAGGAGTTATTTGCTGATGGTTGTGACTTAAATGGGAGACGT
GTGAAGCAACGGTTACATTAG