Details for Arabidopsis Locus AT3G06180

Position : Chr3 ( 5`- 1871688 .. 1873771 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06180

Protein [Map View]
MLHLLLLSDEEHSTTNSMPPSSSASRSASNHSSSSSSSSSSLHLCKHSPSATLDLLILILVLFSGAFLLSSYFSYLFHSF
SLLSSHFPSLSSLIFSDDEDLSSIPPASYFFAFAVFFAASIAFLDLCCGPRSRKCRNPKCKGLKKAMEFDLQLQTEECVK
SGATKEIDRLPWKGGSESNPDYECLRAELRRMAPPNGRAVLLFRSRCGCPVAKLEGWGPKRGRRHKKSQANLALKGGVDH
R*

DNA
ATGCTCCATCTCCTTCTTCTCTCCGACGAAGAACATTCCACCACCAATAGCATGCCCCCTTCCTCCTCCGCCTCTAGATC
CGCCTCCAATCACAGCTCCTCTTCCTCCTCCTCCTCCTCCTCTCTCCACCTCTGCAAGCACTCTCCTTCCGCGACTCTCG
ACCTCCTCATCCTAATCCTCGTCCTCTTCTCCGGCGCTTTCCTCCTCTCCTCTTACTTCTCCTATCTCTTCCACTCCTTT
TCTCTCCTCTCCTCTCACTTCCCTTCCCTCTCCTCCTTGATCTTCTCCGACGATGAAGATCTCTCCTCGATCCCTCCCGC
TTCCTACTTCTTCGCCTTCGCCGTCTTCTTCGCCGCTTCAATTGCGTTTCTCGACCTTTGTTGTGGACCCAGATCGAGGA
AGTGTCGGAATCCCAAGTGTAAAGGTTTGAAGAAAGCGATGGAGTTTGATTTGCAATTGCAGACGGAGGAATGTGTTAAA
TCTGGAGCTACTAAGGAGATCGATCGATTGCCATGGAAAGGAGGTAGTGAGAGCAATCCTGATTACGAGTGTTTGAGGGC
TGAGCTTAGAAGGATGGCTCCGCCTAATGGTCGTGCTGTTTTACTTTTCCGATCTAGATGTGGTTGCCCTGTTGCTAAGC
TTGAAGGTTGGGGTCCTAAACGAGGCCGGCGTCATAAAAAATCGCAAGCGAACTTGGCTCTGAAGGGAGGGGTCGACCAT
CGCTGA