Details for Arabidopsis Locus AT3G06170

Position : Chr3 ( 5`- 1867415 .. 1869948 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06170

Protein [Map View]
MACCLASCCASATCGLCSSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINTSDSYTKEWYQQQAVLRV
SFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSLYGTLSKFGAGAFLLVQVVLLLDA
THNWNDSWVEKDEKKWYIALLVISIVCYIATYTFSGILFIWFNPSGQDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLL
PASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGVKDALL
GDPEDGKKSGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDSSESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAP
LILPDREFY*

DNA
ATGGCGTGTTGCTTAGCTTCGTGCTGTGCGTCGGCGACTTGTGGATTATGCTCGTCGGTAGCATCGGGGATATCGAGGAA
ATCAGCGAGGATCGCTTATTGTGGTCTCTTCGGTGCCTCTCTTGTCGTCTCCTGGATTCTTCGTGAGACTGGTGCTCCGC
TCCTCGAGAAACTCCCTTGGATCAATACTTCTGATTCATATACCAAAGAATGGTATCAGCAACAAGCTGTTCTTCGTGTG
AGCTTTGGGAATTTCCTCTTCTTTGCAATATATGCTTTGATCATGATTGGTGTCAAGGACCAGAATGACAGGCGTGACTC
GTGGCACCATGGTGGGTGGGGTTTGAAGATGATTGTCTGGTTTTTGCTTGTTGTCCTCATGTTTTTTGTTCCAAATGTTA
TCGTCTCGTTATATGGAACGTTGTCAAAATTTGGTGCTGGAGCGTTTCTGTTGGTTCAAGTGGTCTTATTATTAGATGCT
ACACATAACTGGAATGATTCATGGGTCGAAAAGGACGAAAAGAAATGGTACATCGCTCTGCTTGTCATATCAATCGTGTG
TTACATTGCTACATATACCTTCTCAGGAATCCTGTTCATCTGGTTCAACCCATCTGGTCAGGATTGTGGACTTAATGTTT
TCTTCATTGTCATGCCGATGATCTTGGCTTTTGTTTTTGCGATTATTGCTTTACATCCTGCGGTGAATGGCAGTCTTTTA
CCGGCATCAGTTATATCGGTTTACTGTGCTTATGTCTGTTACACGGGCCTCTCTAGCGAACCACATGACTATGTGTGCAA
TGGCCTTAACAAATCCAAGGCAGTGAACGCAAGTACTCTCATCCTTGGAATGCTCACTACGGTTCTCTCGGTTCTATACT
CCGCCCTCCGAGCTGGCTCTTCCACCACATTCCTCTCGCCACCGTCTTCACCCAGATCAGGTGTGAAGGATGCATTGTTA
GGGGACCCTGAGGACGGGAAGAAGAGTGGTGAAGCCGAGGCACGGCCTGTGAGTTACTCATACTCCTTCTTCCATATCAT
CTTTGCGCTTGCGAGCATGTACGCTGCAATGCTTCTCTCGGGATGGACTGACTCATCAGAGAGTGCGACTCTGATCGATG
TGGGATGGACCTCGGTCTGGGTCAAGATATGCACGGGTTGGGTCACGGCCGGACTCTACATATGGACACTCATTGCACCA
CTCATCCTTCCAGATCGCGAGTTCTACTAA