Details for Arabidopsis Locus AT3G06150

Position : Chr3 ( 5`- 1861797 .. 1864116 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06150

Protein [Map View]
MPEKGMIFPPVPSQLVILRPSPLLQWRLGALTALVCFLMLVVWSIDGCSIQSFVQPWRFNAYSVRISPSPSPFMSTKPNL
VSEKPHRQNLTLMMAPRNLVPKKTNLTSNSTRVQFEWITAGSQKNFTANLMRGWLAPGGAPCREAKTVEISVPGVDGIDS
VELTAGEIHEFKFQAIDESGKNVCIGGDYFETDISGENWKSRPPVKDFGNGTYSFSLQVHPEFAGDFNLTVILLFRHYQG
LKFSTSRLGFDRKLRNVRLRFVKTPDVTLPELRSCKKSDFNRDAWSGRWTRLGKNDECQISNDGRYRCLAADFPCRKPWC
DGAVGAIESNGWVYSSHCSFKLFSAEKAWDCLKGKWIFFWGDSNHVDSIRNLLNFVLGHPEIPAVPRRFDMKFSNPKNPS
ETVRITSIFNGHWNETKNYQGLDSLKDRDFRELLKKYFNEETNRVPDVMIVNSGLHDGIHWTSLRAFAKGAETAAAFWRE
VFDGVKSRGLQPPEVIFRNTIATGGYARMLAFNPSKMEAFNGVFLEKMRDAGLVTSVVDNFDMTYPWHYDNRCNDGVHYG
RAPAKMRWRDGEIGHQYFVDLMLVHVLLNALCVR*

DNA
ATGCCGGAGAAAGGAATGATTTTCCCGCCGGTACCGAGCCAATTGGTGATTTTACGGCCAAGCCCTCTTCTTCAATGGCG
GCTTGGTGCTCTTACAGCACTCGTCTGCTTCCTTATGTTAGTCGTTTGGAGTATTGACGGTTGTTCGATTCAAAGCTTCG
TTCAGCCATGGAGATTCAATGCTTACTCTGTTCGAATCAGTCCTTCTCCGTCGCCGTTTATGTCAACGAAACCCAATCTA
GTATCAGAGAAACCTCACCGCCAAAATCTCACCTTGATGATGGCTCCACGAAATCTGGTTCCGAAGAAGACGAATCTCAC
TTCAAACTCGACCCGGGTCCAGTTCGAGTGGATAACCGCTGGATCTCAGAAGAATTTCACGGCGAATTTGATGAGAGGTT
GGTTGGCTCCGGGAGGAGCGCCGTGTAGAGAAGCGAAGACCGTCGAGATTTCAGTTCCCGGTGTCGACGGGATTGATTCT
GTGGAGTTAACCGCCGGAGAGATTCATGAATTCAAATTTCAAGCCATAGACGAATCTGGAAAAAACGTTTGCATTGGTGG
GGACTATTTCGAGACTGATATATCCGGCGAGAACTGGAAATCGAGACCACCGGTGAAAGATTTCGGCAACGGAACTTACT
CTTTCTCTTTACAGGTTCATCCTGAGTTCGCCGGAGATTTCAATCTCACCGTCATTTTACTCTTCCGTCATTACCAAGGT
CTTAAGTTTAGTACCTCACGTTTAGGCTTTGACCGAAAGCTTCGCAATGTTAGATTACGCTTTGTTAAGACGCCTGACGT
TACTCTGCCGGAGCTCCGGTCATGTAAAAAATCTGATTTTAACAGAGATGCTTGGTCTGGACGATGGACTAGGCTTGGGA
AGAATGATGAGTGTCAGATTAGCAATGACGGGCGTTACCGCTGCCTCGCTGCGGATTTCCCTTGCCGGAAACCGTGGTGC
GACGGTGCGGTTGGAGCTATAGAGAGTAATGGTTGGGTTTACTCTAGCCATTGCTCTTTCAAGCTCTTCTCTGCGGAAAA
GGCTTGGGATTGCTTGAAAGGCAAATGGATTTTCTTCTGGGGAGATTCGAATCATGTTGATTCGATCAGAAACTTGCTGA
ATTTCGTCTTGGGTCATCCTGAAATCCCCGCTGTCCCGAGGAGGTTCGATATGAAGTTTTCGAATCCGAAGAACCCTTCG
GAGACTGTTAGGATCACGAGTATCTTTAACGGTCATTGGAACGAGACCAAGAACTATCAGGGCCTTGATTCGCTTAAAGA
CAGGGACTTTAGAGAATTGCTCAAGAAGTACTTCAACGAAGAAACAAACCGTGTTCCCGACGTGATGATCGTGAACTCGG
GTCTACACGACGGGATTCACTGGACTAGTCTTAGAGCCTTTGCGAAAGGTGCTGAAACCGCAGCTGCGTTTTGGAGAGAA
GTTTTTGACGGGGTCAAAAGCAGAGGATTGCAACCGCCAGAAGTGATTTTCAGGAACACAATCGCGACAGGCGGGTACGC
GAGAATGCTAGCGTTTAACCCGAGCAAAATGGAGGCGTTTAACGGAGTGTTTCTCGAGAAAATGAGGGATGCGGGATTGG
TCACGAGCGTAGTTGATAACTTCGATATGACGTATCCGTGGCACTACGATAACCGTTGCAACGATGGAGTTCATTACGGA
AGAGCTCCAGCGAAAATGCGGTGGAGGGACGGTGAGATTGGACATCAGTACTTTGTGGACTTGATGCTCGTTCACGTATT
GCTGAATGCATTGTGTGTAAGATAG