Details for Arabidopsis Locus AT3G06145

Position : Chr3 ( 5`- 1859924 .. 1860650 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06145

Protein [Map View]
MNMKTSKMKFTKEMIESIKDKLPRLSFLRQCYGGCGDRTHLLPCSIATTSTRFWNLSDRPVELQIRVGSILKRVHTLKPG
RSKKLRHRSIHRAYVDDQEGRRWLYYDDTCLPYVWVHETGTDLSKMVKQQYVSLEDLRDYSEIRVFKDLQRGCVAVEKRD
RASALC*

DNA
ATGAATATGAAAACATCAAAGATGAAGTTCACAAAAGAGATGATAGAGTCTATCAAAGACAAGCTCCCGAGGCTCAGCTT
CCTCCGACAATGCTACGGTGGTTGCGGCGACCGGACGCATTTACTCCCTTGCTCCATCGCCACCACTTCCACCCGCTTTT
GGAACCTCTCCGACCGTCCCGTGGAGCTCCAGATTCGGGTCGGTTCAATTCTAAAACGGGTCCACACTCTCAAACCTGGC
CGTTCCAAGAAGCTTAGACACAGAAGCATTCACAGAGCTTACGTTGATGACCAGGAAGGACGTAGATGGCTGTACTACGA
CGACACTTGTCTACCGTACGTATGGGTTCACGAGACTGGTACGGACTTGTCGAAGATGGTGAAGCAACAGTACGTGAGTC
TCGAGGATCTGAGGGATTACTCGGAGATTAGGGTTTTTAAGGATTTACAGAGAGGTTGTGTCGCAGTTGAGAAAAGAGAC
AGAGCTTCTGCTTTGTGTTGA