Details for Arabidopsis Locus AT3G06140

Position : Chr3 ( 5`- 1856682 .. 1858855 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06140

Protein [Map View]
MGISFSNNNRRRDNNNRRHLHHYPPPPPYYYLDPPPPPPPFPPHYDYNYSNYHLSPPLPPQPQINSCSYGHYHYHPQPPQ
YFTTAQPNWWGPMMRPAYYCPPQPQTQPPKPYLEQQNAKKVRNDVNVHRDTVRLEVDDLVPGHHLVSFVFDALFDGSFTI
TFFAKEEPNCTIIPQFPEVYSPTRFHFQKGPGQKFLQPSGTGTDLSFFVLDDLSKPLEEDVYPLVISAETIISPNSISEQ
SSVHKQVTQAVLEKDNDGSFKVKVVKQILWIEGVRYELRELYGSTTQGAASGLDESGSGTECVICMTEAKDTAVLPCRHL
CMCSDCAKELRLQSNKCPICRQPIEELLEIKMNSSDEQH*

DNA
ATGGGAATCTCCTTTAGCAACAACAACAGAAGACGAGACAACAATAATCGTCGCCACCTCCACCACTATCCTCCGCCGCC
GCCTTACTATTACCTCGACCCTCCTCCTCCTCCTCCGCCATTTCCACCGCATTATGACTATAACTACTCCAATTACCATC
TCTCTCCGCCTCTACCGCCACAGCCACAGATCAACTCTTGTTCTTACGGCCATTACCATTATCACCCTCAGCCTCCTCAG
TATTTCACCACCGCTCAGCCCAATTGGTGGGGCCCAATGATGAGACCGGCGTACTACTGTCCGCCTCAGCCGCAAACGCA
ACCGCCTAAGCCATACCTGGAGCAACAGAACGCGAAGAAGGTGAGGAATGATGTCAATGTGCATAGAGATACAGTGAGGC
TTGAAGTGGACGATCTCGTTCCTGGTCACCATCTAGTTTCCTTCGTCTTCGATGCTCTTTTCGACGGCAGTTTCACTATC
ACCTTCTTTGCAAAGGAGGAACCAAATTGCACCATTATCCCACAGTTTCCAGAGGTTTATTCACCCACAAGATTCCATTT
TCAGAAAGGTCCTGGACAGAAGTTTCTGCAGCCTTCAGGGACAGGAACTGACCTGAGCTTCTTTGTTCTTGATGATCTGT
CTAAACCCTTAGAAGAAGATGTGTATCCGCTTGTAATATCAGCTGAGACGATAATCTCTCCAAATTCAATCTCAGAGCAA
TCATCAGTTCATAAGCAAGTCACACAAGCGGTTCTCGAGAAAGATAATGATGGATCTTTCAAAGTGAAAGTTGTGAAGCA
GATTCTTTGGATTGAAGGAGTTCGATATGAACTCCGTGAGTTGTATGGCTCGACCACTCAAGGTGCAGCCTCGGGCTTAG
ATGAGAGTGGTTCGGGTACAGAATGTGTTATCTGCATGACTGAGGCTAAGGACACGGCCGTGCTGCCTTGCAGACATTTG
TGCATGTGTAGCGACTGTGCTAAAGAATTGAGGCTTCAGTCCAACAAATGTCCGATTTGTCGACAACCCATCGAAGAGCT
CTTAGAGATCAAAATGAACAGTAGTGATGAACAACACTAG