Details for Arabidopsis Locus AT3G06130

Position : Chr3 ( 5`- 1852884 .. 1855063 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06130

Protein [Map View]
MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVLIKKLAKSGKHAEIWGAPKGN
NNPNQSQMANQFKGMQIDHGKAGGGGGGNNNNNKKGQKNGGGGGGGGGGGNSNAPKMGQQLNPQHLQQLQQLQKMKGFQD
LKLPPQLKGSVPVNKNQNQKGVKFDVPEDDDDDDFSDEFDDEFTDDDDDEFDDEFDDLPLPSNKMKPNMTMMPNAQQMMM
NAQKNANLAGGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGG
GPMAGGVSGGFRPMGGGGPQNMSMPMGGQMGMGGPMGNMPAVQGLPATGPGGAPQGYFQGAGIDPMQMQQQQQQQQYLAA
VMNQQRAMGNERFQPMMYARPPPAVNYMPPNPHQYPNPHPYPYPYPYPYPPPYGNDQYSHAFSDENTSSCDIM*

DNA
ATGAGTAAAGAAGAGTTCATGAAGATCCAGACTTGTGTTCTTAAAGTGAACATACACTGTGATGGCTGTAAGCAGAAAGT
CAAGAAAATCTTGCAGAAAATCGAAGGTGTTTTCACGACCAAGATTGACTCAGAGCAAGGGAAAGTGACTGTCTCTGGGA
GCGTAGATCCTTCAGTTCTCATCAAGAAGCTCGCCAAATCTGGTAAACATGCTGAAATCTGGGGAGCTCCAAAGGGTAAC
AACAATCCCAATCAGTCCCAAATGGCCAATCAGTTTAAGGGAATGCAGATTGACCATGGAAAAGCCGGAGGCGGTGGTGG
CGGAAACAATAATAACAACAAGAAAGGCCAGAAAAACGGCGGAGGAGGTGGCGGCGGTGGAGGTGGAGGTAACAGTAATG
CGCCAAAGATGGGCCAGCAACTGAATCCACAACATTTGCAGCAGCTTCAACAGCTTCAGAAGATGAAAGGGTTTCAAGAT
CTGAAGCTTCCTCCTCAGTTAAAAGGCTCTGTTCCTGTCAACAAGAACCAAAACCAGAAAGGAGTCAAGTTTGATGTCCC
TGAAGATGATGATGATGATGATTTCAGTGACGAATTCGATGATGAATTTACTGATGATGATGACGACGAGTTTGATGATG
AGTTTGACGATCTCCCTCTTCCGTCTAATAAGATGAAGCCCAACATGACGATGATGCCTAATGCTCAACAGATGATGATG
AACGCTCAGAAGAATGCCAATCTTGCCGGTGGTCCTGCTAAAAACGGCGGTAAAGGCGCTCCCGCTGCTGGCGGCGGCGG
TGCCGGTGGTGGAAAGGGTGCTGGCGGCGGTGCTAAGGGTGGTCCTGGGAATCAAAACCAAGGTGGAGGCAAGAACGGCG
GTGGTGGACATCCACAAGATGGTAAAAACGGCGGTGGAGGCGGTGGTCCCAACGCCGGAAAAAAGGGTAACGGCGGAGGT
GGGCCCATGGCTGGAGGAGTTTCGGGAGGTTTCCGACCCATGGGAGGTGGAGGACCACAGAATATGAGCATGCCAATGGG
TGGTCAAATGGGTATGGGTGGTCCGATGGGGAATATGCCGGCGGTTCAGGGGTTACCAGCGACCGGTCCAGGCGGTGCAC
CACAGGGTTATTTCCAAGGGGCCGGGATAGATCCTATGCAAATGCAGCAACAGCAACAACAACAGCAATATTTAGCGGCG
GTTATGAACCAGCAACGAGCTATGGGGAACGAACGGTTCCAACCAATGATGTACGCAAGGCCACCACCGGCAGTTAACTA
TATGCCGCCAAACCCGCACCAATATCCGAATCCGCATCCGTATCCGTATCCGTACCCGTATCCATATCCTCCACCTTATG
GGAATGATCAATACTCTCATGCCTTTAGCGACGAGAACACATCAAGCTGCGATATTATGTGA