Details for Arabidopsis Locus AT3G06110

Position : Chr3 ( 5`- 1843413 .. 1845014 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06110

Protein [Map View]
MEKVVDLFGVGEANSQKLLEGGKDLSEIQQGLFIGSVAEANNKDFLKSSNITHVLTVAVALAPPYPDDFVYKVIEVVDRS
ETDLTVYFDECYSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAYLMKKHGMGFSKAMELVRSRRHQAYPNPGFISQLQQFE
KSIQGNA*

DNA
ATGGAGAAAGTGGTTGATCTCTTCGGAGTCGGAGAAGCTAATTCCCAGAAGCTACTCGAAGGAGGCAAAGATCTCAGCGA
GATCCAACAGGGATTGTTCATAGGATCAGTAGCTGAAGCGAATAACAAGGATTTTCTCAAAAGCTCTAATATCACTCATG
TCTTAACCGTTGCTGTGGCCTTGGCTCCTCCTTATCCTGATGATTTTGTCTACAAAGTCATTGAAGTGGTTGATAGATCC
GAGACCGATTTGACAGTATATTTCGATGAGTGTTATAGCTTCATCGACCAAGCTATTCAATCTGGTGGTGGTGTTTTGGT
TCATTGCTTCATGGGAATGTCTAGGAGTGTGACTATAGTGGTGGCTTACCTGATGAAAAAGCATGGAATGGGATTCTCTA
AAGCTATGGAACTTGTAAGGAGCCGACGACATCAGGCATATCCTAATCCCGGTTTCATTTCGCAGCTCCAGCAATTTGAA
AAATCCATCCAAGGTAATGCATGA