Details for Arabidopsis Locus AT3G06090

Position : Chr3 ( 5`- 1840773 .. 1841012 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06090

Protein [Map View]
MKMKKLLKVVFLLVAYLTCSIAMASYHGCNRVAEKATRMNVVGEDSRNEFGNYEEKKKKANLWSGRKLASGPSRRGCGH*

DNA
ATGAAGATGAAGAAGCTTCTTAAAGTTGTGTTTCTCTTGGTCGCTTACTTAACTTGTTCCATTGCCATGGCTAGTTACCA
TGGTTGTAACAGGGTTGCAGAGAAGGCAACGAGAATGAATGTAGTCGGAGAAGATTCAAGAAATGAGTTTGGAAACTACG
AGGAGAAGAAGAAGAAGGCGAATTTGTGGTCAGGTCGAAAGTTAGCTTCTGGTCCAAGTCGTAGAGGTTGTGGCCACTAA