Details for Arabidopsis Locus AT3G06080

Position : Chr3 ( 5`- 1834707 .. 1837984 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06080

Protein [Map View]
MSKNSNVEENGGAKPICEALRRFKRSRLVFEPSLGVLGFFLVGVCLVCSFFFFDYRSVAKSYGLSDKSERFVWLKFDNIS
SSSSSSSNSSKRVGFLEESGSGCDVFDGDWVWDESYPLYQSKDCRFLDEGFRCSDFGRSDLFYTQWRWQPRHCNLPRFDA
KLMLEKLRDKRLVFVGDSIGRNQWESLLCLLSSAVKNESLIYEINGSPITKHKGFLVFKFEEYNCTVEYYRSPFLVPQSR
PPIGSPGKVKTSLKLDTMDWTSSKWRDADVLVLNTGHWWNEGKTTRTGCYFQEGEEVKLKMNVDDAYKRALNTVVKWIHT
ELDSNKTQVFFRTFAPVHFRGGDWKTGGTCHMETLPEIGTSLASSETWEQLKILRDVLSHNSNRSETVKVKLLNITAMAA
QRKDGHPSLYYLGPHGPAPLHRQDCSHWCLPGVPDTWNELFYALFMKQEAPSSSKRVEEANSTGNVTMS*

DNA
ATGTCTAAGAACTCAAACGTTGAAGAGAATGGAGGAGCAAAGCCAATCTGTGAAGCTTTGAGGAGATTCAAAAGGTCGAG
GCTTGTGTTCGAGCCGTCTTTAGGAGTGTTGGGGTTTTTCTTGGTTGGGGTCTGTTTGGTTTGCAGTTTTTTCTTCTTTG
ATTACAGAAGCGTTGCTAAAAGCTATGGCCTTTCGGATAAATCTGAGAGATTCGTTTGGCTCAAGTTTGACAATATCAGC
AGCAGCAGCAGTAGTAGTAGTAATAGTTCAAAGAGAGTTGGGTTTCTGGAAGAGAGTGGAAGTGGGTGTGATGTGTTCGA
TGGAGATTGGGTTTGGGACGAGTCTTATCCATTGTATCAATCCAAAGATTGCAGATTTCTCGATGAAGGGTTTAGGTGTA
GTGACTTTGGAAGGTCTGATTTGTTCTATACTCAGTGGCGTTGGCAACCTAGACACTGTAATTTGCCCAGATTTGATGCA
AAACTGATGCTGGAGAAACTCCGGGACAAGCGGCTTGTGTTTGTTGGCGATTCAATAGGAAGAAACCAGTGGGAGTCTCT
ACTTTGTCTACTATCTTCTGCAGTCAAGAACGAGAGCTTGATTTATGAAATAAATGGAAGTCCGATCACAAAGCACAAAG
GGTTCTTGGTGTTCAAATTTGAGGAGTACAATTGCACAGTGGAGTACTACAGATCTCCATTTTTGGTTCCTCAAAGCAGA
CCACCGATTGGATCACCTGGAAAGGTCAAGACAAGTTTGAAACTGGACACTATGGATTGGACTTCAAGCAAATGGAGAGA
TGCTGACGTTTTAGTGCTCAATACTGGACACTGGTGGAACGAGGGGAAAACTACTAGAACGGGATGTTACTTTCAAGAAG
GAGAAGAAGTAAAATTGAAGATGAATGTAGATGATGCTTATAAGCGAGCTCTGAATACCGTTGTGAAATGGATACATACC
GAGCTCGATTCAAACAAAACTCAAGTCTTCTTTCGCACTTTCGCCCCCGTGCATTTCAGGGGAGGAGATTGGAAAACAGG
AGGAACATGTCATATGGAGACATTACCAGAGATTGGAACCTCATTGGCTTCATCAGAGACCTGGGAACAGTTAAAGATCC
TCAGAGATGTGTTGTCACATAACTCAAACAGATCAGAGACTGTTAAAGTGAAACTGTTGAACATAACGGCAATGGCTGCT
CAAAGAAAAGATGGTCACCCATCACTCTACTATCTCGGTCCGCATGGTCCTGCACCGCTTCATCGCCAAGACTGTAGCCA
CTGGTGCCTTCCCGGTGTTCCTGACACGTGGAACGAGCTCTTCTATGCATTATTTATGAAACAAGAAGCTCCTTCTTCTT
CTAAAAGAGTTGAAGAAGCGAACAGTACAGGAAATGTTACAATGTCGTGA