Details for Arabidopsis Locus AT3G06060

Position : Chr3 ( 5`- 1827980 .. 1830200 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06060

Protein [Map View]
MAAISPLFLLFLIPIIPLSLLAILALIVRPRPIKIPIKSRHAFITGGSSGIGLALAHRAASEGARVSILARSGSKLEEAK
KSIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELVKHSPEDVKFTIDVNLVGSFNVIKAALPAMK
ARKDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQQEVISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAII
AASSGSMETEEVAKKAMDGIKAGNFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYKAIEKW
SKTKTK*

DNA
ATGGCGGCCATTTCTCCTCTCTTCCTTCTCTTCCTCATTCCCATTATCCCACTATCGCTTCTCGCTATCTTAGCCCTAAT
TGTACGTCCTCGTCCCATTAAGATCCCTATCAAGTCCCGTCACGCCTTCATCACCGGTGGATCTAGCGGCATCGGTCTTG
CTCTCGCCCACCGCGCCGCTTCCGAGGGCGCTCGTGTCTCAATCCTCGCCCGATCCGGATCAAAGCTCGAGGAGGCTAAG
AAATCGATCCAGCTCGCCACTGGTGTCGAAGTCGCCACATTCTCTGCAGACGTTCGCGATTACGATGCAGTCTCGAAGGC
GATAGATGAATCGGGACCGATCGATGTGTTGATTGTTAACCAAGGTGTGTTTACGGCGAAGGAGCTGGTGAAACATAGTC
CTGAAGATGTCAAATTCACGATTGACGTAAATCTTGTTGGGAGCTTCAATGTGATTAAAGCCGCTTTGCCTGCCATGAAA
GCAAGGAAAGATCGTGGACCTGCTTCCATCAGTCTCGTCTCCTCTCAAGCTGGTCAGGTTGGTGTCTATGGTTATGCTGC
ATATTCAGCAAGCAAGTTTGGTCTTCAGGGTTTAGCGCAAGCATTGCAACAGGAAGTTATATCTGATGATATTCATGTCA
CTCTTATTTTTCCTCCTGACACTAATACACCCGGCTTTGAAGAAGAACAGAAGAGCAGACCTGAAGTCACTGCCATAATA
GCTGCATCCTCTGGTTCAATGGAAACAGAAGAAGTAGCAAAAAAGGCTATGGATGGCATAAAAGCAGGAAACTTCACCGT
CTCATGCAACTTTGAGGGATTCTTACTGTCTCTCGCGACAACCGGCATGTCCCCTCAAAGATCATTTTGGCTTGCTTTTC
TTGAAGTTATAACCGCAGGGCCTATAAGATTAATCGCTCTCTTCTTTCAATGGGATTGGTATAAAGCCATTGAAAAATGG
AGCAAAACCAAAACCAAATGA