Details for Arabidopsis Locus AT3G06050

Position : Chr3 ( 5`- 1826073 .. 1827861 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06050

Protein [Map View]
MAMSILKLRNLSALRSAANSARIGVSSRGFSKLAEGTDITSAAPGVSLQKARSWDEGVSSKFSTTPLSDIFKGKKVVIFG
LPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDPFAINGWAEKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAAL
LGPRSERWSAYVEDGKVKAVNVEEAPSDFKVTGAEVILGQI*

DNA
ATGGCGATGTCAATTCTAAAGCTAAGAAATTTATCGGCACTAAGATCGGCGGCAAATAGTGCCCGGATCGGAGTTTCATC
GAGGGGTTTCTCAAAGCTCGCGGAAGGCACTGACATAACCTCGGCGGCGCCTGGCGTTTCTCTCCAGAAAGCTCGCAGCT
GGGACGAAGGTGTTTCCTCCAAATTCTCCACCACGCCATTGTCAGATATCTTCAAGGGGAAGAAAGTCGTCATCTTTGGT
CTTCCTGGGGCTTACACGGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAGCCACATTGATAAGTTTAAAGCCAA
AGGCATTGATTCTGTCATCTGTGTCTCTGTTAATGATCCCTTTGCTATCAATGGTTGGGCAGAGAAGCTTGGTGCCAAAG
ATGCAATTGAGTTTTATGGAGATTTTGATGGGAAATTTCACAAAAGCTTGGGGCTAGACAAGGATCTCTCTGCTGCATTG
CTCGGGCCACGGTCTGAGAGATGGTCGGCTTATGTAGAAGACGGGAAGGTTAAGGCGGTGAATGTGGAAGAAGCACCGTC
TGACTTCAAGGTTACAGGGGCAGAAGTCATCTTAGGACAGATCTAA