Details for Arabidopsis Locus AT3G06035

Position : Chr3 ( 5`- 1823099 .. 1824216 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06035

Protein [Map View]
MAIDKLPLLLFLSILLCLNRPVLSDTDEEDILLTGINSYRTTQNLTILSKNENAECLADEIADQFKNKPCTNDTGSATVP
GTEPQFANYPQILAKCHLNVSDTRDGSIMPACVPRLESNLVLTNFTKSQYSMSLNDSKFTGIGIGKEDDWIVVVLTTNTP
EGSYSTATPTKQESNGFTFGIGLVSYLVIFMYSSFCFFLF*

DNA
ATGGCGATCGACAAGCTTCCACTTCTTCTCTTTCTCTCCATACTCCTCTGCCTCAATCGCCCTGTTCTTAGCGACACCGA
TGAAGAGGACATTCTTCTCACAGGAATCAACAGCTACAGAACAACACAGAATCTAACAATCTTAAGCAAGAACGAAAACG
CAGAATGCCTAGCTGACGAAATCGCAGACCAATTCAAGAACAAACCTTGTACCAACGACACTGGCTCAGCCACAGTACCT
GGAACTGAGCCACAGTTCGCAAACTACCCTCAGATTCTAGCAAAATGCCACTTGAACGTCTCAGACACGAGAGACGGCTC
GATTATGCCTGCATGTGTTCCTCGTTTAGAATCAAACCTCGTCCTCACAAACTTCACCAAGTCACAATACTCAATGAGTT
TGAACGATTCCAAGTTTACAGGGATTGGTATTGGTAAAGAAGATGATTGGATCGTTGTAGTCCTCACTACCAACACACCA
GAAGGAAGCTATTCTACAGCTACTCCTACAAAACAAGAGTCTAATGGCTTCACCTTTGGTATTGGTCTCGTTAGTTATTT
AGTCATTTTCATGTACTCTTCCTTTTGTTTCTTTCTCTTTTGA