Details for Arabidopsis Locus AT3G06020

Position : Chr3 ( 5`- 1813267 .. 1814169 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06020

Protein [Map View]
MATVVYQSYFESQHFEPRALRLRLSSHTNPQLSTPLKSHFQNSSIAPQDNPITINAASLPSSSPNPSSNSDTNSGSWSFL
ESLSNSSSNDKEKKTLPLFQSPSSRRTLSDESLALCTESLGSETGSDIIHEDMFSISSELQTMETRTTSTTSNPSRQDRK
RNTMASLPPPLTSMIGFDCIEVKSHRENGRLVMMATRPPPRNRCLQDRSNGCVRLAILIDSDDHIETETKEEKEEEEEET
IETVRDNEEEIPEYKEEEEEKEEEIKVKGVEKVQRSRRCIEGDRENRGFLNWESLCVATS*

DNA
ATGGCAACTGTTGTATATCAATCTTATTTTGAGTCTCAACACTTTGAGCCAAGAGCTCTCAGACTCAGACTCTCTTCTCA
TACAAATCCTCAACTATCCACACCTCTCAAATCCCATTTCCAAAATTCTTCCATTGCTCCACAAGACAACCCTATTACCA
TTAATGCAGCCTCCTTGCCCTCATCAAGTCCCAACCCGAGCTCTAACTCGGACACCAACTCGGGAAGTTGGAGCTTCCTC
GAGTCCCTTTCAAACTCGAGCTCTAATGATAAAGAGAAGAAGACATTACCACTCTTTCAATCTCCATCCTCTCGTAGAAC
TCTCAGCGACGAGAGCTTAGCATTGTGCACTGAGAGCCTTGGGAGCGAGACGGGCTCTGATATCATTCATGAAGATATGT
TCTCGATTTCATCTGAATTACAAACTATGGAAACTAGAACCACGTCGACAACATCGAATCCATCAAGACAAGATAGGAAG
AGGAATACAATGGCTTCACTTCCACCTCCTTTGACAAGTATGATAGGTTTTGATTGCATTGAAGTCAAGTCGCACCGTGA
AAACGGAAGATTAGTAATGATGGCCACGAGACCTCCTCCGCGTAATCGTTGCCTTCAGGACCGAAGCAATGGCTGTGTCA
GACTCGCTATCTTGATTGATTCTGATGACCACATAGAGACAGAGACCAAAGAAGAAAAAGAAGAAGAAGAGGAAGAAACA
ATCGAGACCGTGAGAGATAACGAAGAAGAGATTCCAGAATACAAGGAAGAAGAAGAAGAAAAAGAAGAAGAAATCAAAGT
AAAGGGTGTTGAGAAAGTTCAAAGATCAAGAAGATGTATTGAAGGAGATCGAGAAAACAGAGGATTTCTAAATTGGGAAT
CTTTATGTGTTGCCACTTCCTAA