Details for Arabidopsis Locus AT3G06000

Position : Chr3 ( 5`- 1801446 .. 1802081 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G06000

Protein [Map View]
MVDTSLTNEDTIEETAFETCTHIKVGVSMSKPFSSFSFLTVINLSYTNLENGGAIALVNALKNSAPSLQVIEMAGNNITY
EAATAIAVCLAAKRHLKKLNLSENDLKDEGCVEIVKSMEDWELEYVDMSYNDLRREGALRLARVVVKKGSFKMLNIDGNM
ISLKGIEEIKVIFTNCPKLLGPLDKNVYNVDDDDDLRENDEDEFVSVFIFY*

DNA
ATGGTGGACACTAGCTTAACCAATGAGGATACTATAGAGGAGACTGCATTCGAGACTTGTACTCATATAAAAGTTGGAGT
TTCTATGAGCAAACCATTTTCAAGCTTCAGTTTCTTGACTGTAATTAATCTAAGTTATACAAATCTAGAGAATGGAGGTG
CTATAGCTTTAGTAAACGCTCTCAAGAACTCCGCTCCATCTCTTCAAGTTATAGAAATGGCTGGAAATAACATAACTTAT
GAGGCGGCTACAGCTATCGCAGTTTGTTTGGCAGCAAAGAGACATCTGAAAAAGTTGAATTTGTCTGAAAATGATCTAAA
AGATGAGGGATGTGTTGAGATTGTAAAGAGTATGGAAGATTGGGAGTTAGAATATGTTGATATGAGCTACAATGACTTGA
GAAGAGAAGGAGCATTGCGCTTGGCTCGTGTTGTTGTCAAGAAAGGAAGTTTCAAGATGTTGAACATTGATGGAAATATG
ATCTCTCTTAAAGGCATTGAGGAAATCAAAGTGATATTCACGAATTGTCCAAAGTTACTTGGACCTTTGGATAAGAACGT
ATATAATGTGGATGATGATGATGATTTAAGAGAGAATGATGAAGATGAATTTGTGAGTGTATTTATCTTTTATTAG