Details for Arabidopsis Locus AT3G05980

Position : Chr3 ( 5`- 1795337 .. 1796486 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05980

Protein [Map View]
MVLETVSKTEPPPLLGPRISFSSDLSDGGDFICITPVMCKEDVVKGSVKVSDFEFLSSENVSPQRMLTADELFSEGKLLP
FWQVKHSEKLKNITLKTNEEEEAEKRKVEVKKKDQEINNRDNRVTWFIDEDPSPRPPKCTVLWKELLRLKKQRNPSSSPV
TARTVSSLSPSSSTSSSSSLEDAAKREEKEKEGKRGKKGLERTRSASMRIRPMIHVPICTPSKSSLPLPPLFPLSLKKNR
VERRA*

DNA
ATGGTTTTAGAGACGGTTTCAAAGACGGAACCACCACCGTTGCTTGGACCTCGTATCTCCTTCTCATCTGATTTATCTGA
CGGTGGAGATTTCATCTGCATCACCCCCGTAATGTGTAAGGAAGATGTCGTCAAAGGGTCAGTGAAAGTCTCCGACTTTG
AGTTCTTGTCGTCGGAAAATGTGAGTCCACAGAGAATGCTTACCGCCGATGAACTCTTCTCCGAAGGTAAATTGCTTCCT
TTTTGGCAAGTAAAGCACTCAGAGAAGCTTAAAAACATTACTTTGAAGACGAACGAAGAGGAAGAAGCAGAGAAACGTAA
AGTGGAAGTGAAGAAGAAAGATCAGGAGATTAACAATAGAGATAACAGAGTGACTTGGTTTATAGACGAAGATCCGTCTC
CTCGTCCTCCCAAGTGTACCGTTCTTTGGAAAGAGCTTTTGAGATTGAAGAAACAGAGGAATCCGTCTTCTTCGCCGGTG
ACGGCGAGGACAGTGTCGTCTTTGTCTCCGTCGTCGTCCACGTCATCATCAAGTTCACTTGAGGACGCAGCGAAGAGAGA
GGAGAAAGAGAAAGAAGGGAAGAGAGGTAAGAAAGGATTAGAGAGAACGAGATCGGCGAGTATGAGGATAAGGCCAATGA
TTCATGTTCCTATTTGCACTCCTTCTAAATCCTCTCTTCCTTTGCCTCCTCTGTTTCCTCTTTCGCTTAAGAAAAACAGA
GTAGAGAGACGCGCCTAG