Details for Arabidopsis Locus AT3G05975

Position : Chr3 ( 5`- 1792145 .. 1792714 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05975

Protein [Map View]
MSKRRICCIVSGIIFVLFVIFMTALILAQVFKPKHPILQTVSSTVDGISTNISLPYEVQLNFTLTLEMLLKNPNVADFEY
KTVENLVYYRDTLVGNLTLPSSTLPAKGSVLLPCPLFLQLDKFVANLGDIVQDVLHGKIVMETRAKMPGKITLLGIFKIP
LDSISHCNLVLGFPSMVVEDQVCDLKTKL*

DNA
ATGTCCAAGCGACGCATTTGCTGCATAGTTTCCGGAATCATCTTTGTCCTCTTCGTAATCTTCATGACCGCTTTGATCCT
TGCACAAGTGTTCAAACCAAAACATCCGATACTACAAACCGTCTCTTCAACTGTTGATGGCATATCTACAAATATATCAC
TACCATACGAGGTCCAACTAAATTTCACTCTTACGCTGGAGATGCTGCTCAAGAATCCTAACGTTGCGGATTTTGAATAC
AAGACAGTGGAAAACTTGGTTTATTACAGGGATACACTAGTCGGAAATCTCACACTTCCTTCGAGCACATTACCTGCCAA
AGGTTCAGTGCTTTTGCCATGTCCTCTATTTCTCCAGCTCGATAAATTTGTCGCGAATTTAGGTGATATCGTGCAAGATG
TATTGCATGGAAAAATTGTGATGGAGACAAGAGCAAAAATGCCAGGAAAAATCACTTTGTTGGGAATCTTTAAGATACCT
TTGGATTCAATATCGCATTGCAATCTCGTACTCGGCTTTCCTTCAATGGTAGTGGAGGACCAAGTGTGTGATCTCAAAAC
TAAGCTGTAA