Details for Arabidopsis Locus AT3G05940

Position : Chr3 ( 5`- 1777364 .. 1780254 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05940

Protein [Map View]
MADLLPIYLIILAFLCTVGAIALALFHIYKHLLNYTEPIYQRYIVRIVFMVPVYALMSFLALVLPKSSIYFNSIREVYEA
WVIYNFLSLCLAWVGGPGSVVISLTGRSLKPSWHLMTCCIPPLPLDGRFIRRCKQGCLQFVILKPILVAVTLVLYAKGKY
KDGNFSPDQSYLYLTIIYTISYTVALYALVLFYVACKDLLQPFNPVPKFVIIKSVVFLTYWQGVLVFLFAKSGFIRDEEE
AALFQNFIICVEMLIAAAAHFYAFPYKEYAEANVGGARSFSGSLAHALMLNDFYHDTVHQFAPTYHDYVLYNHNDGGEEG
TRKYRARTFVPTGQEMDAVRKNKHMFGNKIDGVSVSSQSSETSTPKTSGVTYDPARPESMKSSLLVDASDSVSTMYDMSL
IDIDISSYPSKVPSANISGGPK*

DNA
ATGGCGGATTTGTTACCCATTTACCTCATTATTTTGGCATTTCTATGCACTGTCGGAGCCATTGCTTTGGCTTTATTCCA
TATCTACAAGCACCTATTGAACTATACGGAACCCATTTATCAGAGATATATTGTGCGCATTGTCTTCATGGTCCCGGTTT
ATGCCTTGATGTCATTCTTGGCTCTCGTTTTGCCCAAGAGCTCTATATATTTTAACTCTATCCGTGAAGTTTACGAAGCA
TGGGTGATATATAATTTTCTATCGCTGTGTTTGGCCTGGGTTGGAGGCCCAGGTTCGGTAGTTATAAGTTTAACTGGTCG
CTCTCTGAAGCCATCTTGGCATCTCATGACGTGTTGCATCCCACCACTACCATTAGACGGGCGTTTTATTAGACGATGCA
AGCAAGGTTGTCTGCAATTTGTTATTCTAAAGCCAATCCTAGTTGCTGTCACACTTGTGCTTTATGCAAAAGGGAAATAC
AAGGATGGAAATTTTAGCCCTGATCAATCCTATCTCTATCTTACCATCATCTATACAATATCATACACTGTAGCTCTGTA
CGCGCTGGTCCTCTTTTATGTGGCATGCAAAGATCTGCTTCAGCCATTCAATCCAGTCCCAAAATTTGTGATTATAAAGT
CTGTTGTCTTTCTAACCTATTGGCAGGGTGTTCTAGTTTTCCTTTTTGCTAAATCTGGATTTATAAGGGATGAAGAAGAA
GCAGCCCTCTTCCAAAATTTTATAATATGTGTGGAAATGCTTATTGCTGCAGCTGCTCATTTCTATGCATTTCCGTACAA
GGAATATGCAGAGGCCAATGTTGGAGGAGCTCGCAGTTTCTCAGGAAGTCTGGCACATGCTCTTATGCTAAACGATTTCT
ACCATGATACTGTTCACCAGTTTGCACCAACATATCACGATTATGTGCTCTATAATCATAATGATGGGGGTGAGGAAGGG
ACAAGGAAGTACCGAGCACGAACATTTGTGCCAACTGGTCAGGAAATGGATGCTGTTAGAAAGAACAAACACATGTTTGG
AAACAAGATAGATGGTGTTTCGGTCTCCAGTCAATCTTCAGAAACAAGCACACCCAAAACCTCTGGTGTAACTTATGATC
CTGCACGCCCTGAGAGCATGAAATCTTCCTTGCTGGTAGATGCCTCGGACTCTGTTTCCACAATGTATGACATGTCGCTC
ATTGACATTGATATATCGAGCTACCCTAGCAAGGTACCTTCTGCAAATATAAGTGGAGGACCTAAATAG