Details for Arabidopsis Locus AT3G05937

Position : Chr3 ( 5`- 1775902 .. 1776775 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05937

Protein [Map View]
MKRVVKKVVCMRLKSARRLKRVVWSRLKTAFFYRRRRFLRLLHPNKSSSYCFY*

DNA
ATGAAGAGAGTGGTGAAGAAAGTTGTTTGTATGAGGTTGAAATCTGCTAGAAGATTGAAACGCGTCGTTTGGTCGCGGCT
GAAAACGGCGTTTTTCTACCGCCGTAGACGTTTCCTTCGTCTCCTTCATCCAAACAAATCCTCTTCCTACTGTTTCTACT
AG