Details for Arabidopsis Locus AT3G05935

Position : Chr3 ( 5`- 1771962 .. 1772599 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05935

Protein [Map View]
MNNEQNERDPDNINNKKKKKESPLLIYSVSKAKKRIVSKFRRRPLSPNTSPSSGFWKRVCFCGIEPDPEDDNFKLRVLLQ
TNDFFSKDSNPHLCL*

DNA
ATGAACAATGAACAGAACGAGAGAGATCCTGATAACATCAACAACAAGAAGAAGAAAAAGGAATCTCCATTGTTGATTTA
CTCCGTCTCGAAAGCAAAGAAACGAATCGTGTCTAAGTTCAGAAGGAGACCCTTATCGCCGAATACGTCTCCTTCTTCTG
GGTTTTGGAAAAGAGTCTGCTTTTGTGGAATTGAACCTGACCCTGAAGATGACAACTTTAAGCTTAGGGTTCTGCTACAG
ACCAATGATTTCTTCTCCAAGGATTCTAATCCACATCTCTGTTTGTAA