Details for Arabidopsis Locus AT3G05870

Position : Chr3 ( 5`- 1753467 .. 1755631 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05870

Protein [Map View]
MKVKILRILLWHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAHCPMCR
REWQFKE*

DNA
ATGAAAGTCAAGATCTTGCGTATCCTTTTATGGCATGCAGTTGCTTCATGGACATGGGATGCTCAAGACGAAACATGTGG
GATATGTCGGATGGCTTTTGATGGTTGTTGTCCTGATTGCAAACTTCCTGGAGATGATTGCCCTCTAATTTGGGGAGCCT
GCAACCACGCGTTTCATCTTCACTGTATATTGAAATGGGTGAATTCGCAGACGAGCCAAGCTCATTGCCCAATGTGCAGA
AGAGAATGGCAGTTCAAAGAGTAA