Details for Arabidopsis Locus AT3G05860

Position : Chr3 ( 5`- 1751406 .. 1752355 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05860

Protein [Map View]
MTRKKLNLSYITNESMRKATFNKRKKGLVKKIHELSVLCGIEACAVIYSPFNSNPEVWPSNSEVKNVMENFEMLTKLEQE
KKMVSHEGFIRQNISKTMESNNKKMIDNAERTMKEAMFQLLSGKGEKLNLTDRNREDLCKYIDQYLKELYHHKNKTINQS
HIEPGESSGATNAMTPTSVVEPIISSIQRPNQNPNFNHLSHNQYQYQQQFGYPILVQDGIYNPSQIQNQHEEWLDDHMMN
HSKEISHPLMDDNNFYYQQP*

DNA
ATGACGAGGAAGAAGCTAAACCTATCTTACATCACCAATGAGTCAATGAGAAAAGCAACATTCAATAAGAGAAAGAAAGG
GCTTGTGAAAAAAATCCACGAGCTTTCCGTTCTCTGCGGAATCGAAGCATGTGCAGTGATTTATAGTCCGTTCAACTCAA
ACCCTGAAGTCTGGCCATCGAATTCAGAAGTTAAAAATGTAATGGAAAATTTTGAGATGTTGACAAAGTTGGAGCAAGAG
AAGAAAATGGTGAGCCACGAAGGTTTTATCAGACAAAACATCTCAAAAACTATGGAGAGTAACAACAAAAAGATGATCGA
TAATGCGGAGAGGACGATGAAAGAAGCCATGTTCCAACTTCTTAGTGGAAAAGGGGAGAAGCTTAATTTGACTGATAGAA
ACCGTGAAGATTTGTGTAAGTACATTGATCAATATCTTAAAGAACTTTATCACCACAAAAACAAAACCATAAATCAATCA
CATATTGAACCTGGAGAATCTTCGGGAGCTACAAATGCCATGACACCAACATCTGTTGTTGAACCTATTATCTCTTCAAT
CCAGCGACCAAATCAGAATCCAAATTTTAATCATCTTAGTCATAATCAATATCAATATCAACAACAGTTTGGATATCCGA
TTTTGGTTCAAGATGGAATTTACAATCCGAGTCAAATTCAGAATCAACATGAGGAATGGCTGGATGATCATATGATGAAT
CATTCTAAGGAAATAAGTCATCCTTTGATGGATGATAACAACTTTTACTACCAACAACCCTAG