Details for Arabidopsis Locus AT3G05858

Position : Chr3 ( 5`- 1749342 .. 1749871 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05858

Protein [Map View]
MGGKNRSHSSKRFSLFSFFKTRRSHRVEADGSWDDFGYTRKAMASDEDKRYWVAEPGIDRKASAFIAKFHATRVSESERQ
TLSPYRSEKA*

DNA
ATGGGTGGTAAAAATAGATCTCACAGTAGCAAGAGGTTCTCTCTCTTCAGCTTCTTCAAAACACGAAGATCTCACAGAGT
GGAAGCAGACGGCTCATGGGACGACTTCGGTTACACTCGCAAGGCAATGGCTAGTGATGAAGACAAACGTTATTGGGTCG
CTGAACCAGGCATCGACCGTAAAGCGTCTGCCTTCATCGCCAAGTTTCATGCAACTCGTGTCTCTGAGTCTGAGCGCCAG
ACTCTCTCTCCTTACCGATCCGAAAAGGCATGA