Details for Arabidopsis Locus AT3G05830

Position : Chr3 ( 5`- 1736677 .. 1738664 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05830

Protein [Map View]
MSYSEKTTVDPLLRDLDEKKESFRRNVVSLATELKQVRGRLVSQEQSFLKETITRKEAEKRGKNMEMEICKLQKRLEERN
CQLEASASAADKFIKELEEFRLKLDTTKQTAEASADSAQSTKIQCSMLKQQLDDKTRSLREQEDRMTQLGHQLDDLQRGL
SLRECSEKQLREEVRRIEREVTEAIAKAGIGGMDSELQKLLEDVSPMKFERMNRLVEVKDEEITKLKDEIRLMSGQWKHK
TKELESQLEKQRRTDQDLKKKVLKLEFCLQEARSQTRKLQRFYCCCCFVMNGAQKGERRDMEIKEIRDLISEKQNLNNES
WDKQKFWDNSGFKIVVSMSMLMLVVVSKR*

DNA
ATGTCTTATTCTGAAAAAACGACGGTGGATCCACTTCTGAGAGATTTGGATGAGAAGAAAGAGAGTTTCCGGCGAAACGT
GGTGTCTCTGGCTACGGAGCTGAAGCAAGTGAGGGGCCGTTTGGTTTCTCAAGAACAATCTTTTCTTAAAGAGACCATTA
CTAGAAAAGAAGCAGAGAAAAGGGGAAAGAATATGGAAATGGAGATTTGTAAATTGCAGAAGAGACTGGAAGAAAGGAAT
TGTCAGCTTGAAGCTTCTGCATCTGCTGCTGATAAGTTTATCAAAGAGTTGGAGGAATTTAGATTAAAGCTTGATACAAC
CAAGCAAACCGCAGAGGCAAGTGCTGATTCTGCTCAATCTACAAAGATCCAATGCTCAATGCTAAAGCAACAACTTGACG
ACAAAACACGTTCTCTCAGAGAACAAGAAGACCGTATGACTCAGCTTGGTCATCAGCTTGATGATCTACAGAGAGGTCTG
AGCTTGAGAGAGTGCTCAGAAAAGCAGCTTAGAGAAGAAGTTAGGAGAATCGAGCGTGAGGTTACTGAGGCCATTGCAAA
AGCGGGAATAGGTGGCATGGACAGCGAGCTCCAGAAACTTCTAGAAGATGTGTCTCCAATGAAATTTGAGAGGATGAATA
GGCTAGTTGAAGTAAAAGACGAAGAGATTACAAAACTGAAAGATGAGATAAGGTTAATGTCAGGTCAATGGAAACATAAG
ACTAAGGAACTCGAATCTCAGCTGGAGAAACAGAGAAGAACTGATCAAGATTTGAAGAAGAAGGTATTGAAGCTAGAGTT
CTGTTTACAAGAAGCTCGAAGCCAGACAAGAAAGCTGCAGAGGTTTTATTGTTGTTGCTGTTTTGTTATGAATGGAGCAC
AGAAAGGGGAAAGAAGGGACATGGAGATCAAAGAGATAAGAGATCTTATATCGGAGAAGCAAAACCTTAACAATGAGTCT
TGGGATAAACAGAAGTTCTGGGACAATTCAGGGTTCAAGATTGTTGTATCAATGTCTATGTTGATGTTAGTGGTAGTCTC
CAAGAGATGA