Details for Arabidopsis Locus AT3G05770

Position : Chr3 ( 5`- 1710013 .. 1712165 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05770

Protein [Map View]
MSMKRSREESQGGGNHNRFVDEGPRLNLPLTKTPELINKIESYLKVHYTCPHQQTENSSKTSTLPKSPEKLKAMNFPIST
IKIGDCVFVAKNPDDIVAKFYFAKKKLLWEFLFGEPVANMPRLKSKIEIQWNDVSSFEESINSRDETGILKIELKKRPTF
FTETNPQAGKHTQWKQLDYDFTGDQASYYRRHTLHFPPGVLQKNLEKLLTDSFWSKLYKVPFPVHESLYFDIGFENNNSS
NGHSKTVGFNVNNGLQHDFSQVRDLKERKKIITLIGIGGVGEGEGNFSMANGGWQRNSYSHVNSLNYNTDNGLLGMQAIP
PSSQVANEHYNNTQNDYTGSQFGYRMNQDEIQKMQRIGKILESQAYAVPDTQTKLTSSGMNNGPMYPPAGSYLESRLLEE
WYEHTRRFQQ*

DNA
ATGTCCATGAAGAGATCACGAGAAGAATCTCAAGGTGGCGGCAACCATAACAGATTTGTTGATGAGGGACCACGTCTAAA
CTTGCCTCTAACAAAAACTCCGGAACTTATCAACAAGATTGAAAGTTACCTCAAAGTACACTACACATGTCCTCATCAAC
AAACAGAGAACTCATCAAAGACATCAACTCTTCCCAAGTCTCCTGAGAAACTAAAAGCTATGAATTTCCCAATCTCCACG
ATCAAGATTGGCGACTGTGTCTTCGTTGCCAAAAACCCTGATGACATTGTGGCCAAATTCTATTTTGCAAAGAAGAAACT
TTTATGGGAGTTTCTCTTCGGAGAACCAGTGGCTAACATGCCGAGGCTGAAGAGTAAGATCGAGATTCAATGGAATGATG
TCTCATCTTTTGAAGAGAGTATTAATTCACGTGATGAAACTGGAATCCTCAAAATCGAGTTGAAAAAACGTCCAACATTC
TTCACAGAGACTAATCCACAGGCAGGAAAACACACTCAATGGAAACAATTGGATTACGATTTCACCGGAGATCAGGCTTC
TTATTACAGGAGACATACACTTCATTTTCCTCCCGGAGTTCTGCAAAAGAACTTGGAGAAGCTTCTGACCGACAGCTTCT
GGTCCAAACTCTATAAAGTCCCTTTCCCGGTACATGAATCTCTTTACTTCGATATTGGCTTTGAAAACAACAACTCATCT
AACGGCCACAGCAAGACAGTTGGCTTCAACGTCAACAATGGCCTTCAACATGACTTTTCTCAAGTGAGAGACTTAAAAGA
AAGAAAAAAAATCATTACTTTGATAGGAATTGGTGGCGTGGGAGAGGGAGAAGGAAACTTTAGCATGGCTAACGGTGGAT
GGCAAAGAAACTCATATAGTCATGTCAATAGTCTGAATTATAACACTGATAATGGGTTGCTTGGGATGCAAGCTATCCCA
CCATCGTCTCAGGTGGCTAACGAGCATTATAATAACACGCAAAACGATTACACCGGCTCACAGTTTGGTTATCGGATGAA
CCAAGACGAGATCCAAAAGATGCAAAGAATAGGGAAGATACTTGAGAGTCAAGCATATGCAGTACCTGATACACAAACTA
AATTGACGTCTTCAGGCATGAACAATGGCCCAATGTATCCTCCGGCTGGATCGTATCTAGAAAGCAGATTGCTTGAAGAA
TGGTATGAACATACAAGAAGATTTCAGCAGTAG