Details for Arabidopsis Locus AT3G05750

Position : Chr3 ( 5`- 1704120 .. 1707678 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05750

Protein [Map View]
MVEMEAVERKRSRGGFLNMFDWPGKSRKKLFSSSSSSSKLSEGSKQEKQNAQNPSKSWPSLIEGDEIGKNSTYNPRSDSS
CSTSTPTSDDGQGSKAPSVVARLMGLESIPVPNALEPRRNPDFDPYFLRSSRKASTWDAYENLGYVNLRSDYDGISWDHL
DSRMNKECNRPIDRFQTETLPPRSAKPIPVTHNRLLSPIRSPGFVQSRNPASVMEEASRMIEPSPRVVAKTRFSSSDSSS
SLPMKIRDLKEKLEASQKGQSPQISNGTCNNKCFRGKQDEKRTTLPLKTQERNNLLGESRFGGSKGKVKPPSVSAHAKAN
TIHKRDSSMLSNGYRDQKKKVETKNRIVKSGLKESSASTRKTVDKPNNQKQNQFAETSVSNQRGRKVMKKVNKVLVENGT
TTKKPGFTATSAKKSTSSSLSRKKNLSRSKKPANGVQEAGVNSDKRIKKGEKVIKCNITVDGGLKTGDDDRKKDMDVISF
TFSSPIKGLSSDSQYFLKKNDQDAESALCFNKIDSDSLNFLLEKKLRELTSKMESSCSSLTQEEESSGSITKDWVNGTRS
LPSDDQDNGLSESESDSDYSSSFYKKKIFQAEDDEEVNSFSTAENLQISCSTSFSSSRNDYHHNIEETELSESVALSEAE
EGHDWELEYITEIIASGQLMIKEFSLGMATDILPLSLFDETEGKRDARGKIERKTLFDLVNQWLTLKCEQMFMGTCKGVL
GKQDIFLERREILADQVLKEAQGLKKMREMMMDELVDNDMSSCEGKWLDYMRETYEEGIEIEEEIVSELVDDLINDLIMC
C*

DNA
ATGGTAGAAATGGAGGCTGTTGAGAGGAAACGATCCAGAGGAGGTTTTCTAAATATGTTTGATTGGCCTGGTAAATCCCG
TAAGAAGCTCTTCTCCTCTAGCAGCAGCAGCTCGAAACTCTCCGAAGGATCAAAGCAAGAGAAACAAAATGCTCAAAACC
CCTCAAAGTCATGGCCCTCTCTGATTGAGGGAGATGAGATTGGAAAGAATTCAACTTACAATCCCAGAAGTGACTCGAGT
TGTTCAACATCCACTCCCACTAGTGATGATGGACAAGGTTCCAAAGCTCCAAGTGTTGTTGCGAGGCTCATGGGTTTAGA
GTCTATACCTGTACCAAATGCCTTGGAGCCCCGGCGTAATCCTGATTTTGATCCATACTTCCTCAGATCCTCACGCAAGG
CAAGCACATGGGATGCATATGAGAATTTGGGTTATGTAAATCTCCGCAGTGACTATGATGGTATTTCTTGGGACCATTTG
GATTCAAGAATGAACAAGGAGTGTAACCGGCCTATCGACCGCTTTCAAACCGAAACGTTACCTCCAAGGTCGGCTAAACC
AATCCCTGTCACCCACAATAGGCTCTTGTCTCCTATCCGGAGTCCTGGGTTTGTTCAGTCCAGGAACCCTGCTTCTGTAA
TGGAAGAAGCTTCGAGAATGATTGAACCAAGTCCTCGGGTAGTTGCTAAAACACGGTTTTCATCATCTGATTCCTCTTCA
TCACTTCCAATGAAAATCAGAGATTTGAAAGAGAAACTAGAAGCTTCACAGAAAGGACAAAGCCCTCAAATCTCAAATGG
CACTTGCAATAATAAGTGCTTCAGAGGAAAGCAAGATGAAAAGAGAACTACATTACCACTCAAGACACAAGAGCGAAATA
ATTTATTGGGAGAAAGCAGGTTTGGTGGTTCGAAGGGTAAAGTGAAGCCGCCCTCTGTATCTGCACATGCAAAGGCCAAT
ACTATTCACAAGCGAGACAGTTCAATGCTCTCAAATGGCTACAGAGACCAAAAGAAGAAGGTGGAAACTAAGAACCGCAT
AGTAAAAAGTGGTCTTAAAGAATCTTCTGCTAGCACTAGGAAAACCGTTGATAAGCCAAATAACCAGAAACAGAACCAAT
TTGCTGAAACGTCTGTTTCAAATCAGAGAGGCAGAAAAGTGATGAAGAAAGTAAACAAAGTTTTGGTGGAAAACGGAACT
ACAACTAAGAAGCCTGGTTTTACAGCAACATCAGCGAAAAAGAGCACTTCTTCATCTTTGTCCCGCAAAAAGAATCTTTC
CCGCAGCAAAAAACCGGCAAATGGGGTGCAAGAAGCTGGAGTTAACAGTGATAAACGGATCAAAAAGGGTGAGAAGGTGA
TAAAATGTAACATCACCGTCGATGGCGGGTTGAAGACAGGGGACGATGATCGAAAGAAGGACATGGATGTGATTTCGTTC
ACTTTCTCATCCCCGATCAAAGGTTTATCATCAGATTCGCAATACTTTTTAAAAAAGAATGATCAAGATGCAGAGTCAGC
ACTTTGTTTCAATAAGATAGATAGTGATTCTCTAAATTTTCTGTTGGAGAAAAAGCTCAGAGAACTAACCTCTAAGATGG
AGTCATCTTGCAGTAGTCTGACCCAAGAAGAAGAGTCTTCGGGTTCCATTACAAAGGATTGGGTGAATGGGACAAGATCA
TTGCCGTCAGATGATCAGGATAACGGTTTATCAGAAAGCGAATCTGATTCTGACTATAGTAGTTCATTCTACAAAAAGAA
AATATTCCAGGCAGAAGATGATGAGGAAGTTAACAGTTTCAGCACTGCCGAAAATCTCCAAATCTCCTGCAGCACGAGTT
TCTCAAGTTCACGCAATGATTATCACCATAACATTGAAGAAACCGAACTCTCAGAATCTGTTGCTTTATCAGAAGCTGAA
GAAGGTCATGACTGGGAGCTCGAGTACATAACGGAGATCATTGCCTCTGGCCAACTGATGATTAAAGAATTCTCCTTGGG
GATGGCTACTGATATATTACCTCTGAGCTTATTCGATGAAACCGAAGGCAAGAGAGATGCTCGGGGAAAGATCGAGAGAA
AAACACTGTTTGACTTGGTGAATCAGTGGTTAACACTCAAATGCGAGCAGATGTTCATGGGAACCTGCAAAGGAGTGTTG
GGGAAACAAGACATTTTTCTTGAAAGGAGAGAGATTTTGGCAGACCAAGTGTTGAAAGAGGCTCAGGGATTGAAGAAGAT
GAGAGAGATGATGATGGATGAGCTAGTTGACAATGACATGAGTAGTTGTGAAGGGAAATGGCTTGATTACATGAGAGAGA
CTTACGAAGAAGGAATTGAGATTGAAGAAGAGATTGTGTCCGAATTAGTTGATGACTTAATTAATGATCTTATCATGTGT
TGTTGA