Details for Arabidopsis Locus AT3G05740

Position : Chr3 ( 5`- 1698112 .. 1701399 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05740

Protein [Map View]
MKDQDLELEKVRLISLATKLGFDEDSAKKCLDRFVDLYGDDGRDFITVELCGDDFLAALADFEEGTEEWDDIQAIESEAQ
GNLAEMFDKSTNPSDNGFDTDDDDDDSRVEVHVIEDSPEPKKKPEIVELDSSSDLEDVETRFKVPRRSQTCSRSMDYSME
DSVSTISGRKPSVQISNKDHETPSYEELQALDDLEFANLVIFGNKVFRPLQHQACRASMERKDCFVLMPTGGGKSLCYQL
PATLKAGVTIVISPLLSLIQDQIVALNLKFGIPATFLNSQQTSSQAAAVLQELRRDNPSCKLLYVTPEKIAGSSSFLETL
RCLDRKGLLAGFVVDEAHCVSQWGHDFRPDYRELGCLKQNFPRVPVMALTATATESVCQDVLKSLRIPRAPVLKMSFDRI
NLKYEVIVKTKEPLKQLQELLRDRFKDQSGIVYCLSKSECVDVAKFLNEKCKVKTVYYHAGVPAKQRVDVQRKWQTGEVR
IVCATIAFGMGIDKADVRFVIHNTLSKAVESYYQESGRAGRDGLQAQCICLYQKKDFSRVVCMLRNGQGRNMDRFKSAMA
QAKKMQQYCELKTECRRQMLLEYFGESFDRMICKSSLNPCDNCERS*

DNA
ATGAAGGATCAAGATCTCGAATTGGAGAAAGTTCGATTAATAAGCCTAGCTACAAAGCTCGGATTCGACGAAGATTCTGC
GAAGAAATGCTTGGATCGATTCGTCGATCTTTACGGTGATGATGGTCGGGATTTCATCACTGTTGAGTTATGTGGAGATG
ATTTTCTTGCGGCGTTAGCTGATTTTGAGGAAGGAACTGAGGAATGGGATGATATACAGGCTATAGAGTCTGAAGCTCAA
GGAAATTTGGCTGAAATGTTTGATAAATCTACTAATCCTAGTGATAACGGATTCGATACTGATGATGATGATGATGATTC
AAGAGTCGAAGTTCATGTTATTGAGGATTCTCCTGAGCCTAAGAAAAAGCCAGAGATAGTGGAGTTGGATTCTTCTAGTG
ATTTGGAAGATGTTGAGACGCGTTTTAAAGTTCCAAGGAGATCACAAACATGTTCCAGATCTATGGACTATTCCATGGAG
GATTCAGTTTCAACAATTTCAGGCAGAAAACCTTCTGTCCAGATATCAAACAAGGACCATGAAACTCCGAGTTACGAAGA
GTTGCAGGCATTGGATGATCTTGAATTTGCAAACTTGGTGATTTTTGGGAACAAGGTGTTTCGGCCCCTGCAGCATCAAG
CATGTAGAGCTTCTATGGAAAGGAAGGATTGTTTTGTTCTAATGCCAACGGGAGGGGGGAAAAGTTTGTGTTACCAGCTT
CCTGCAACACTAAAAGCTGGAGTGACCATAGTTATATCTCCTCTGTTGTCCCTCATCCAAGATCAGATAGTTGCGCTTAA
CCTTAAGTTCGGGATACCAGCTACTTTTCTCAACTCTCAGCAAACATCTTCTCAAGCAGCAGCTGTATTACAAGAACTTA
GAAGAGATAATCCGTCATGTAAACTCTTATACGTGACACCTGAGAAAATCGCTGGAAGTTCATCCTTTTTGGAGACACTA
AGATGTTTAGACCGCAAGGGACTGCTGGCAGGTTTTGTGGTTGATGAGGCTCACTGCGTGAGCCAATGGGGGCACGACTT
CCGGCCAGACTACAGGGAACTGGGATGTCTTAAGCAGAACTTTCCCCGTGTTCCTGTGATGGCTCTTACAGCAACGGCAA
CTGAATCAGTCTGTCAGGACGTACTAAAAAGTCTGAGAATTCCCAGGGCTCCGGTTCTGAAGATGAGCTTTGACAGAATC
AACTTGAAGTATGAGGTGATCGTCAAAACAAAGGAGCCGCTGAAACAGCTCCAAGAGCTGCTAAGAGATCGGTTCAAGGA
TCAGTCTGGGATTGTTTACTGTCTCTCCAAAAGTGAATGTGTGGATGTTGCCAAGTTTCTGAACGAGAAATGCAAGGTGA
AGACAGTTTATTACCATGCCGGGGTGCCTGCAAAACAAAGAGTTGATGTCCAGAGGAAATGGCAAACAGGGGAAGTCCGA
ATAGTTTGTGCAACTATCGCATTTGGGATGGGAATAGACAAAGCAGACGTGCGTTTTGTTATCCACAACACCTTGTCGAA
AGCTGTGGAAAGTTACTACCAAGAGTCAGGGAGAGCAGGAAGGGACGGGCTTCAAGCGCAGTGCATTTGCTTGTACCAGA
AGAAAGATTTCAGCAGAGTCGTTTGCATGTTACGAAACGGACAAGGCAGAAACATGGATAGATTTAAGTCAGCCATGGCT
CAGGCAAAGAAGATGCAGCAATACTGTGAGCTCAAGACAGAATGCAGAAGACAGATGTTGCTAGAGTACTTTGGAGAGTC
ATTCGACCGGATGATTTGTAAAAGCAGTTTAAATCCGTGTGATAACTGTGAAAGAAGCTGA