Details for Arabidopsis Locus AT3G05727

Position : Chr3 ( 5`- 1693552 .. 1694138 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05727

Protein [Map View]
MAKTFSSICFTTLLLVVLFISTEIPKSEAHCDHFLGEAPVYPCKEKACKSVCKEHYHHACKGECEYHGREVHCHCYGDYH
*

DNA
ATGGCAAAGACCTTCAGCTCCATCTGCTTCACCACTCTTTTGCTCGTTGTCTTGTTCATCTCTACCGAAATCCCGAAGAG
CGAGGCTCACTGTGATCACTTTTTGGGGGAAGCCCCAGTGTACCCATGTAAGGAAAAAGCTTGTAAATCCGTATGTAAGG
AGCACTACCACCACGCATGTAAAGGAGAGTGCGAGTATCATGGCCGCGAAGTGCATTGCCACTGCTACGGTGATTATCAC
TGA